Property Summary

NCBI Gene PubMed Count 15
PubMed Score 8.89
PubTator Score 7.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 3.8e-08
invasive ductal carcinoma 2951 1.4e-02
osteosarcoma 7950 2.6e-02

Expression

  Differential Expression (3)

Disease log2 FC p
invasive ductal carcinoma -1.200 1.4e-02
malignant mesothelioma -2.600 3.8e-08
osteosarcoma 1.240 2.6e-02

Synonym

Accession Q9Y5J5 B2R5A4 Q53HD6 Q8NBW9
Symbols TIH1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRH      1 - 70
IYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS                  71 - 127
//

Text Mined References (17)

PMID Year Title