Property Summary

NCBI Gene PubMed Count 56
PubMed Score 163.39
PubTator Score 152.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
glioblastoma 1.600 4.0e-07
oligodendroglioma 2.300 4.3e-03
adrenocortical carcinoma 1.068 4.2e-02
adult high grade glioma 1.500 4.4e-04
astrocytic glioma 1.400 3.2e-02
Astrocytoma, Pilocytic 1.600 5.0e-07
atypical teratoid / rhabdoid tumor -1.200 1.7e-02
Breast cancer -1.400 1.8e-02
interstitial cystitis -1.100 2.2e-03
lung adenocarcinoma -1.300 2.9e-13
malignant mesothelioma 2.300 5.0e-08
nephrosclerosis 1.361 3.0e-04
ovarian cancer -1.500 4.6e-05
posterior fossa group B ependymoma 1.400 2.4e-05
psoriasis -1.400 9.1e-03
tuberculosis -3.100 5.0e-08

Gene RIF (33)

AA Sequence

MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLS      1 - 70
ELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSI     71 - 140
IEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASP    141 - 210
TEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALS    211 - 280
PSAPTQAANLGKPYRPWGTEIGAF                                                  281 - 304
//

Text Mined References (57)

PMID Year Title