Property Summary

NCBI Gene PubMed Count 53
Grant Count 68
R01 Count 56
Funding $3,463,882.59
PubMed Score 153.62
PubTator Score 152.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma 1.900 0.000
glioblastoma 1.600 0.000
oligodendroglioma 2.300 0.004
nephrosclerosis 1.361 0.000
malignant mesothelioma 2.300 0.000
psoriasis -1.400 0.009
atypical teratoid / rhabdoid tumor -1.200 0.017
adrenocortical carcinoma 1.316 0.012
tuberculosis -3.500 0.000
interstitial cystitis -1.200 0.002
lung adenocarcinoma -2.800 0.000
pediatric high grade glioma 1.700 0.000
pilocytic astrocytoma 1.600 0.000
posterior fossa group B ependymoma 1.400 0.000
Breast cancer -1.400 0.018
ovarian cancer -1.500 0.000

Synonym

Accession Q9Y5J3 B2R883 Q5TZS3 Q8NAM2 Q9NYP4
Symbols CHF2
OAF1
HERP2
HESR1
HRT-1
hHRT1
BHLHb31

Gene

PDB

2DB7  

Gene RIF (30)

PMID Text
26068074 Expression of Hey1 induces translocation of FBXO45 into the nucleus.
25799559 bone morphogenic proteins within the serum of cell culture medium are potent inducers of endothelial Hey1 and Hey2 gene expression within the first few hours after medium change
25742474 MMP9 was a downstream effector of HEY1 that promotes the invasion of osteosarcoma cells. Knockdown of HEY1 decreased the expression of MMP9.
25361534 Overexpression of HEY1 and HEY2 in esophageal squamous cell carcinoma (ESCC) is correlated to different indices of poor prognosis, and it is extrapolated that such overexpression is important in progression and development of ESCC tumorigenesis.
24684754 In prostate tumors, the overexpression of PTOV1 was associated with decreased expression of HEY1 and HES1, and this correlation was significant in metastatic lesions.
24487962 PML degradation mechanism through Notch/Hey1-induced repression of the PML deubiquitinase USP11 involved in brain tumour pathogenesis
24366871 a new HRD1-associated membrane protein named HERP2, which is homologous to the previously identified HRD1 partner HERP1. Despite sequence homology, HERP2 is constitutively expressed in cells, whereas HERP1 is highly induced by ER stress.
24124145 The identification of HEY1-NCOA2 can be used as an auxiliary diagnostic tool to differentiate meningeal hemangiopericytoma from mesenchymal chondrosarcoma.
23900217 HEY1 was overexpressed in colorectal cancer, and correlated with perineural and vascular invasion and lymph node metastasis as well as poorer prognosis.
23379739 Data show that the periodontal ligament-derived mesenchymal stem cells (hPDLSCs) on a Jagged-1-modified surface had increased expression of Notch signaling target genes, Hes-1 and Hey-1, suggesting the involvement of Notch signaling in hPDLSCs.
More...

AA Sequence

MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLS      1 - 70
ELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSI     71 - 140
IEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASP    141 - 210
TEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALS    211 - 280
PSAPTQAANLGKPYRPWGTEIGAF                                                  281 - 304
//

Text Mined References (54)

PMID Year Title
26068074 2015 Hey bHLH Proteins Interact with a FBXO45 Containing SCF Ubiquitin Ligase Complex and Induce Its Translocation into the Nucleus.
25985737 2015 C8orf4 negatively regulates self-renewal of liver cancer stem cells via suppression of NOTCH2 signalling.
25799559 2015 Serum induces transcription of Hey1 and Hey2 genes by Alk1 but not Notch signaling in endothelial cells.
25742474 2015 Hairy/enhancer-of-split related with YRPW motif protein 1 promotes osteosarcoma metastasis via matrix metallopeptidase 9 expression.
25361534 2015 Notch Signaling Target Genes are Directly Correlated to Esophageal Squamous Cell Carcinoma Tumorigenesis.
24684754 2014 Prostate tumor OVerexpressed-1 (PTOV1) down-regulates HES1 and HEY1 notch targets genes and promotes prostate cancer progression.
24487962 2014 USP11 regulates PML stability to control Notch-induced malignancy in brain tumours.
24366871 2014 Role of HERP and a HERP-related protein in HRD1-dependent protein degradation at the endoplasmic reticulum.
24124145 2013 Are meningeal hemangiopericytoma and mesenchymal chondrosarcoma the same?: a study of HEY1-NCOA2 fusion.
23900217 2013 Notch-induced transcription factors are predictive of survival and 5-fluorouracil response in colorectal cancer patients.
More...