Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.92
PubTator Score 1.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4740 3.1e-05
colon cancer 1478 1.0e-04
psoriasis 6694 2.5e-04
Multiple myeloma 1332 4.9e-04
dermatomyositis 966 4.2e-03
invasive ductal carcinoma 2951 4.7e-03
ovarian cancer 8520 1.7e-02
Waldenstrons macroglobulinemia 765 2.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (8)

Disease log2 FC p
colon cancer 1.400 1.0e-04
dermatomyositis 1.300 4.2e-03
invasive ductal carcinoma 1.200 4.7e-03
lung cancer 1.700 3.1e-05
Multiple myeloma 1.667 4.9e-04
ovarian cancer 1.400 1.7e-02
psoriasis 1.400 2.5e-04
Waldenstrons macroglobulinemia 1.273 2.8e-02

 GO Function (1)

AA Sequence

MPPERRRRMKLDRRTGAKPKRKPGMRPDWKAGAGPGGPPQKPAPSSQRKPPARPSAAAAAIAVAAAEEER      1 - 70
RLRQRNRLRLEEDKPAVERCLEELVFGDVENDEDALLRRLRGPRVQEHEDSGDSEVENEAKGNFPPQKKP     71 - 140
VWVDEEDEDEEMVDMMNNRFRKDMMKNASESKLSKDNLKKRLKEEFQHAMGGVPAWAETTKRKTSSDDES    141 - 210
EEDEDDLLQRTGNFISTSTSLPRGILKMKNCQHANAERPTVARISSVQFHPGAQIVMVAGLDNAVSLFQV    211 - 280
DGKTNPKIQSIYLERFPIFKACFSANGEEVLATSTHSKVLYVYDMLAGKLIPVHQVRGLKEKIVRSFEVS    281 - 350
PDGSFLLINGIAGYLHLLAMKTKELIGSMKINGRVAASTFSSDSKKVYASSGDGEVYVWDVNSRKCLNRF    351 - 420
VDEGSLYGLSIATSRNGQYVACGSNCGVVNIYNQDSCLQETNPKPIKAIMNLVTGVTSLTFNPTTEILAI    421 - 490
ASEKMKEAVRLVHLPSCTVFSNFPVIKNKNISHVHTMDFSPRSGYFALGNEKGKALMYRLHHYSDF        491 - 556
//

Text Mined References (23)

PMID Year Title