Property Summary

NCBI Gene PubMed Count 42
PubMed Score 102.36
PubTator Score 79.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.400 2.1e-05
psoriasis -1.500 4.5e-49

Gene RIF (25)

AA Sequence

MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLAT      1 - 70
MRDLLQYIACFFAFFSAGFLIVATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAE     71 - 140
HPLKLVVTRALMITADILAGFGFLTLLLGLDCVKFLPDEPYIKVRICFVAGATLLIAGTPGIIGSVWYAV    141 - 210
DVYVERSTLVLHNIFLGIQYKFGWSCWLGMAGSLGCFLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAA    211 - 280
GVSMAKSYSAPRTETAKMYAVDTRV                                                 281 - 305
//

Text Mined References (42)

PMID Year Title