Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.66
PubTator Score 2.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Thyrotoxicosis 38 3.087 1.5
Carcinoma 2,147 1.0

Expression

Gene RIF (3)

PMID Text
23204437 CTCF/cohesin-mediated DNA looping is required for protocadherin alpha promoter choice
18496207 A polymorphic copy number variation in this locus, a 16.7-kb deletion affecting PCDH-alpha exons 8-10 (alpha 8-alpha 10 Delta), was analyzed in this study as a potential candidate variant in schizophrenia and bipolar disorder.
18496207 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVFSRRGGLGARDLLLWLLLLAAWEVGSGQLHYSIPEEAKHGTFVGRVAQDLGLELAELVPRLFRVASKT      1 - 70
HRDLLEVNLQNGILFVNSRIDREELCQWSAECSIHLELIADRPLQVFHVEVKVKDINDNPPVFRGREQII     71 - 140
FIPESRLLNSRFPIEGAADADIGANALLTYTLSPSDYFSLDVEASDELSKSLWLELRKYLDREETPELHL    141 - 210
LLTATDGGKPELQGTVELLITVLDVNDNAPLFDQAVYRVHLLETTANGTLVTTLNASDADEGVNGEVVFS    211 - 280
FDSGISRDIQEKFKVDSSSGEIRLIDKLDYEETKSYEIQVKAVDKGSPPMSNHCKVLVKVLDVNDNAPEL    281 - 350
AVTSLYLPIREDAPLSTVIALITVSDRDSGANGQVTCSLMPHVPFKLVSTFKNYYSLVLDSALDRESLSV    351 - 420
YELVVTARDGGSPSLWATARVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADAQENALV    421 - 490
SYSLVERRVGERALSNYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDEND    491 - 560
NAPALLAPRVGGTIGAVSELVPRLVGAGHVVAKVRAVDADSGYNAWLSYELQPAAGGARIPFRVGLYTGE    561 - 630
ISTTRVLDEADLSRYRLLVLVKDHGEPALTATATVLVSLVESGQAPKASSRASVGVAGPEAALVDVNVYL    631 - 700
IIAICAVSSLLVLTLLLYTALRCSVPPTEGAYVPGKPTLVCSSALGSWSNSQQRRQRVCSSEGPPKTDLM    701 - 770
AFSPGLSPSLNTSERNEQPEANLDLSGNPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWP    771 - 840
TVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIRQEPTNSQIDK    841 - 910
SDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ                                  911 - 950
//

Publication (13)

PMID Year Title
23204437 2012 CTCF/cohesin-mediated DNA looping is required for protocadherin ? promoter choice.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
18496207 2008 Analysis of protocadherin alpha gene deletion variant in bipolar disorder and schizophrenia.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
11230163 2001 Comparative DNA sequence analysis of mouse and human protocadherin gene clusters.
10835267 2000 Phylogenetic analysis of the cadherin superfamily allows identification of six major subfamilies besides several solitary members.
10817752 2000 Cadherin superfamily genes: functions, genomic organization, and neurologic diversity.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
More...