Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.38
PubTator Score 1.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Hypoplastic Left Heart Syndrome 14 0.0 0.0
Disease Target Count P-value
psoriasis 6694 8.6e-06
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.2
Disease Target Count Z-score Confidence
Cervix carcinoma 10 3.173 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 8.6e-06

AA Sequence

MLSSWQGGPRPRQLLLWLLILAAWETGSGQLHYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRVASKR      1 - 70
HGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFHVEVKVRDINDNPPIFPESKKRI     71 - 140
IIAESRPPETRFPLDGASDADIGVNSALTYRLDPNDYFTLDAQNSLEQMSSLSLVLRKTLDREEIQEHSL    141 - 210
LLTASDGGKPELTGTVQLLITILDVNDNAPEFYQSVYKVTVLENAFNGTLVIKLNATDPDDGTNGDIVYS    211 - 280
FRRPVWPAVVYAFTINPNNGEIRTKGKLDFEEKKLYEISVEAVDKGNIPMAGHCTLLVEVLDVNDNAPEV    281 - 350
TITSLSLPIREDTQPSAIIALISVSDRDSGSNGQVTCTLTPHVPFKLVSTYKNYYSLVLDSALDRESVSA    351 - 420
YELVVTARDGGSPSLWATASVSVGVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAQDADAQENALV    421 - 490
SYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDSGVPPLGSNVTLQVFVLDEND    491 - 560
NAPALLTPGAGSAGGTVSELMPRSVGAGHVVAKVRAVDADSGYNAWLSYELQLAAVGARIPFRVGLYTGE    561 - 630
ISTTRPLDEVDAPHHRLLVLVKDHGEPALTATATVLLSLVESGQAPQASSRASAGAVGPEAALVDVNVYL    631 - 700
IIAICAVSSLLVLTLLLYTALRCSAPPTEGACAPGKPTLVCSSAAGSWSYSQQRRPRVCSGEGPHKTDLM    701 - 770
AFSPSLPPCLGSAEGTGQREEDSECLKEPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWP    771 - 840
TVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIRQEPTNSQIDK    841 - 910
SDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ                                  911 - 950
//

Text Mined References (8)

PMID Year Title