Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.09
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 0.000

Synonym

Accession Q9Y5H8 O75286 PCDH-alpha-3
Symbols PCDH-ALPHA3

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
23192925 This study suggested that PCDHA3 as a candidate gene for restless legs syndrome.
19054571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLFSWREDPGAQCLLLSLLLLAASEVGSGQLHYSVSEEAKHGTFVGRIAQDLGLELAELVPRLFRVASKR      1 - 70
HGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFHVEVEVKDINDNAPVFPMAVKNL     71 - 140
FISESRQPGSRFSLEGASDADIGTNSLLTYSLDSTEYFTLDVKRNDEEIKSLGLVLKKNLNREDTPKHYL    141 - 210
LITAIDGGKPELTGTTQLKITVLDVNDNAPAFERTIYKVRLLENAPNGTLVVTVNATDLDEGVNKDIAYS    211 - 280
FNTDMSADILSKFHLDPVNGQISVKGNIDFEESKSYEIQVEATDKGNPPMSDHCTVLLEIVDINDNVPEL    281 - 350
VIQSLSLPVLEDSPLSTVIALISVSDRDSGVNGQVTCSLTPHVPFKLVSTFKNYYSLVLDSPLDRESVSA    351 - 420
YELVVTARDGGSPSLWATASVSVEVADVNDNAPAFSQSEYTVFVKENNPPGCHIFTVSARDADAQENALV    421 - 490
SYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNVTLQVFVLDEND    491 - 560
NAPALLMPRVGGIGGAVSELVPRSVGAGHVVAKVRAVDADSGYNAWLSYELQPGTGGARIPFRVGLYTGE    561 - 630
ISTTRALDEVDAPRHRLLVLVKDHGEPSLTATATVLVSLVESGQAPKASSQASAGATGPEAALVDVNVYL    631 - 700
IVAICAVSSLLVLTLLLYTALRCSAPPTEGDCGPGKPTLVCSSAVGSWSYSQQRQQRVCSGEGLPKTDLM    701 - 770
AFSPSLPPCPISRDREEKQDVDVDLSAKPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWP    771 - 840
TVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIRQEPTNSQIDK    841 - 910
SDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ                                  911 - 950
//

Publication (12)

PMID Year Title
23192925 2012 Exome sequencing in a family with restless legs syndrome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
19054571 2009 Polymorphisms in genes involved in neurodevelopment may be associated with altered brain morphology in schizophrenia: preliminary evidence.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230163 2001 Comparative DNA sequence analysis of mouse and human protocadherin gene clusters.
10835267 2000 Phylogenetic analysis of the cadherin superfamily allows identification of six major subfamilies besides several solitary members.
10817752 2000 Cadherin superfamily genes: functions, genomic organization, and neurologic diversity.
10716726 2000 Large exons encoding multiple ectodomains are a characteristic feature of protocadherin genes.
More...