Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.50
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
20388442 The promoter methylation and mRNA expressions of EMP3 and PCDH-gamma-A11 are closely related with the malignant development of glioma.
15799819 PCDH-gamma-A11 is silenced epigenetically in astrocytic gliomas

AA Sequence

MANRLQRGDRSRLLLLLCIFLGTLRGFRARQIRYSVPEETEKGSFVGNISKDLGLEPRELAKRGVRIVSR      1 - 70
GKTQLFAVNPRSGSLITAGRIDREELCETVSSCFLNMELLVEDTLKIYGVEVEIIDINDNAPSFQEDEVE     71 - 140
IKVSEHAIPGARFALPNARDPDVGVNSLQSYQLSPNNYFSLQLRGRTDGAKNPELVLEGSLDREKEAAHL    141 - 210
LLLTALDGGDPIRKGAVPIRVVVLDVNDHIPMFTQSVYRVSVPENISSGTRVLMVNATDPDEGINGEVMY    211 - 280
SFRNMESKASEIFQLDSQTGEVQVRGSLDFEKYRFYEMEIQGQDGGGLFTTTTMLITVVDVNDNAPEITI    281 - 350
TSSINSILENSPPGTVIALLNVQDQDSGENGQVSCFIPNHLPFKLEKTYGNYYKLITSRVLDRELVQSYN    351 - 420
ITLTATDQGSPPLSAETHVWLNVADDNDNPPVFPHSSYSAYIPENNPRGASIFSVTALDPDSKQNALVTY    421 - 490
SLTDDTVQGVPLSSYVSINSNTGVLYALQSFDYEQFRDLELRVIARDSGDPPLSSNVSLSLFVLDQNDNA    491 - 560
PEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPGLFAVGEHTGEVRTA    561 - 630
RALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADSIPEVLADLGSLESLANSETSDLSLYLVVAVAA    631 - 700
VSCIFLVFVIVLLALRLWRWHKSRLLQASEGGLAGMPTSHFVGVDGVQAFLQTYSHEVSLIADSQKSHLI    701 - 770
FPQPNYGDTLISQESCEKSEPLLIAEDSAIILGKCDPTSNQQAPPNTDWRFSQAQRPGTSGSQNGDDTGT    771 - 840
WPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNA    841 - 910
AGKRDGKAPAGGNGNKKKSGKKEKK                                                 911 - 935
//

Text Mined References (12)

PMID Year Title
20388442 2010 [The methylation analysis of EMP3 and PCDH-gamma-A11 gene in human glioma].
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15799819 2005 Epigenetic silencing of the protocadherin family member PCDH-gamma-A11 in astrocytomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230163 2001 Comparative DNA sequence analysis of mouse and human protocadherin gene clusters.
10835267 2000 Phylogenetic analysis of the cadherin superfamily allows identification of six major subfamilies besides several solitary members.
10817752 2000 Cadherin superfamily genes: functions, genomic organization, and neurologic diversity.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10716726 2000 Large exons encoding multiple ectodomains are a characteristic feature of protocadherin genes.
More...