Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 6.3e-62
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Liver cancer 604 0.0 0.6
Melanoma 711 0.0 0.5
lung cancer 4740 0.0 0.6
Disease Target Count Z-score Confidence
Invasive lobular carcinoma 5 4.011 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 6.3e-62

Gene RIF (1)

AA Sequence

MAALQKLPHCRKLVLLCFLLATLWEARAGQIRYSVREEIDRGSFVGNIAKDLGLEPLALAEQGVRIVSRG      1 - 70
RSQLFALNPRSGSLVTANRIDREELCAQSAPCLLNFNILLEDKLTIYSVEVEITDINDNAPRFGVEELEL     71 - 140
KISETTTPGFRIPLKNAHDADVGENALQKYALNPNDHFSLDVRRGADGNKYPELVLERSLDREEEAVHHL    141 - 210
VLVASDGGDPVLSGTSRICVKVLDANDNAPVFTQPEYRISIPENTLVGTRILTVTATDADEGYYAQVVYF    211 - 280
LEKSPGETSEVFELKSTSGELTIIKDLDYEDATFHEIDIEAQDGPGLLTRAKVIVTVLDVNDNAPEFYMT    281 - 350
SATSSVSEDSLPGTIIGLFNVHDRDSGQNAFTTCSLPEDLPFKLEKSVDNYYRLVTTRALDREQFSFYNI    351 - 420
TLTAKDGGNPSLSTDAHILLQVADINDNAPAFSRTSYSTYIPENNPRGASVFSVTAHDPDSNDNAHVTYS    421 - 490
FAEDTVQGAPLSSYISINSDTGVLYALRSFDYEQLRDLQVWVIARDSGNPPLSSNVSLSLFVLDQNDNAP    491 - 560
EILYPAFPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYHLLKASEPGLFSVGLHTGEVRTAR    561 - 630
ALLDRDALKQSLVVAIQDHGQPPLSATVTLTVAVADRIPDILADLGSLEPSAIPNDSDLTLYLVVAVAAV    631 - 700
SCVFLAFVIVLLAHRLRRWHKSRLLQASGGSLTGMQSSHFVGVDGVRAFLQTYSHEVSLTADSRKSHLIF    701 - 770
PQPNYADTLISQESCEKKDFLSAPQSLLEEEREETFSQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTWPN    771 - 840
NQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGK    841 - 910
RDGKAPAGGNGNKKKSGKKEKK                                                    911 - 932
//

Text Mined References (9)

PMID Year Title