Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.88
PubTator Score 1.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 0.000

Gene RIF (2)

PMID Text
26608278 Deletions within this VCD region that disrupt the association altered trafficking of Pcdh-gammaA3 in the endolysosomal system.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTNCLSFRNGRGLALLCALLGTLCETGSGQIRYSVSEELDKGSFVGNIANDLGLEPRELAERGVRIVSRG      1 - 70
RTQLFSLNPQSGSLVTAERIDREELCAQIPLCLVKINILVEDKLKIFEVEIEIKDINDNAPNFPTEELEI     71 - 140
KIGELTVPGTRFPIKTAFDPDVGINSLQNYKLSPNDYFSLAVNSVSEGAKYPELVLERALDREKKEIHQL    141 - 210
VLVASDGGDPVHSGNLHIQVIVLDANDNPPMFTQPEYRVSVWENVPVGTRLLTVNATDPDEGFNAQVSYI    211 - 280
LDKMPGKIAEIFHLNSVSGEVSILKSLDYEDAMFYEIKIEAQDGPGLLSRAKILVTVLDVNDNAPEITIT    281 - 350
SLTSSVPEEGTVGREIALIDVHDRDSGQNGQVEVFVLGNLPFKLEKSIDQYYRLVTATSLDREQISEYNI    351 - 420
SLRASDGGSPPLSTETHITLHVIDINDNPPTFPHLSYSAYIPENNPRGASIFSVTAQDPDSNNNARITYA    421 - 490
LTEDTLQGAPLSSFVSINSNTGVLYALRSFDYEQFRDLKLLVTASDSGNPPLSSNVSLNLFVLDQNDNAP    491 - 560
EILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTAR    561 - 630
ALLDRDALKQSLVVAVQDHGQPPLSATVTLTVAVADRIPDILADLGSLEPSAKPNDSDLTLYLVVAVAAV    631 - 700
SCVFLAFVIVLLALRLRRWHKSRLLQASGGGLASTPGSHFVGADGVRAFLQTYSHEVSLTADSRKSHLIF    701 - 770
PQPNYADTLISQESCEKSEPLLITQDLLEMKGDSNLLQQAPPNTDWRFSQAQRPGTSGSQNGDDTGTWPN    771 - 840
NQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGK    841 - 910
RDGKAPAGGNGNKKKSGKKEKK                                                    911 - 932
//

Publication (9)

PMID Year Title
26608278 2015 The clustered protocadherin endolysosomal trafficking motif mediates cytoplasmic association.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230163 2001 Comparative DNA sequence analysis of mouse and human protocadherin gene clusters.
10835267 2000 Phylogenetic analysis of the cadherin superfamily allows identification of six major subfamilies besides several solitary members.
10817752 2000 Cadherin superfamily genes: functions, genomic organization, and neurologic diversity.
10716726 2000 Large exons encoding multiple ectodomains are a characteristic feature of protocadherin genes.
10380929 1999 A striking organization of a large family of human neural cadherin-like cell adhesion genes.