Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.14
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
aldosterone-producing adenoma -1.131 4.7e-02
atypical teratoid/rhabdoid tumor 1.200 2.3e-02
Breast cancer -1.300 2.5e-04
group 4 medulloblastoma 1.800 1.8e-03
invasive ductal carcinoma -1.400 3.5e-03
lung carcinoma 2.000 5.3e-18
ovarian cancer -1.100 1.3e-02

Gene RIF (1)

AA Sequence

MEIRGALDLRKRQVLIFLVLLGLSRAGTESAHYSVAEETEIGSFVANLARDLGLGVEELSSREARVVSDD      1 - 70
NKKYLHLDLLTGNLLLNEKLDRDELCGSTEPCVLHFQVVLENPLQFFRFELCVKDINDHSPTFLDKEILI     71 - 140
KISEGTTVGATFLMESAQDLDVGSNSLQNYTISPNSHFYIKIPDSSDRKIYPELVLDRALDYEQEAELRL    141 - 210
TLTAVDGGSPPKSGTTLVLIKVLDINDNAPEFPQSLYEVQVPEDRPLGSWIATISAKDLDAGNYGKISYT    211 - 280
FFHASEDIRKTFEINPISGEVNLRSPLDFEVIQSYTINIQATDGGGLSGKCTLLVKVMDINDNPPEVTIS    281 - 350
SITKRIPENASETLVALFSILDQDSGDNGRMICSIQDNLPFFLKPTFKNFFTLVSEKALDRESQAEYNIT    351 - 420
ITVTDLGTPRLKTEYNITVLLSDVNDNAPTFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVNYSL    421 - 490
LPPQDRHLPLASLVSINADNGHLFALRSLDYEALQEFEFRVGATDRGSPALSSEALVRVLVLDANDNSPF    491 - 560
VLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLL    561 - 630
SERDAAKHRLVVLVKDNGEPPRSATATLHVLLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSSL    631 - 700
FLFSVLLFVAVRLCRRSRAASVGRCSVPEGPFPGHLVDVSGTGTLSQSYQYEVCLTGGSGTNEFKFLKPI    701 - 770
IPNFQVHDTGRNMGEIENFRNSFGLNIQ                                              771 - 798
//

Text Mined References (15)

PMID Year Title