Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.14
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 5.32447273900821E-18
Breast cancer 3099 2.50989713784915E-4
group 4 medulloblastoma 1875 0.00177220030101987
invasive ductal carcinoma 2950 0.00351437053939673
ovarian cancer 8492 0.0128463847549095
atypical teratoid/rhabdoid tumor 1095 0.0229114689402184
aldosterone-producing adenoma 664 0.0474756067810426
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (7)

Disease log2 FC p
group 4 medulloblastoma 1.800 0.002
atypical teratoid/rhabdoid tumor 1.200 0.023
aldosterone-producing adenoma -1.131 0.047
lung carcinoma 2.000 0.000
Breast cancer -1.300 0.000
invasive ductal carcinoma -1.400 0.004
ovarian cancer -1.100 0.013

Synonym

Accession Q9Y5E9 B4DPE2 Q4FZA4 Q4KN11 PCDH-beta-14
Symbols PCDH-BETA14

Gene

PANTHER Protein Class (2)

  Ortholog (4)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid

Gene RIF (1)

PMID Text
25566775 PCDHB14- and GABRB1-like nervous system developmental genes are altered during early neuronal differentiation of NCCIT cells treated with ethanol

AA Sequence

MEIRGALDLRKRQVLIFLVLLGLSRAGTESAHYSVAEETEIGSFVANLARDLGLGVEELSSREARVVSDD      1 - 70
NKKYLHLDLLTGNLLLNEKLDRDELCGSTEPCVLHFQVVLENPLQFFRFELCVKDINDHSPTFLDKEILI     71 - 140
KISEGTTVGATFLMESAQDLDVGSNSLQNYTISPNSHFYIKIPDSSDRKIYPELVLDRALDYEQEAELRL    141 - 210
TLTAVDGGSPPKSGTTLVLIKVLDINDNAPEFPQSLYEVQVPEDRPLGSWIATISAKDLDAGNYGKISYT    211 - 280
FFHASEDIRKTFEINPISGEVNLRSPLDFEVIQSYTINIQATDGGGLSGKCTLLVKVMDINDNPPEVTIS    281 - 350
SITKRIPENASETLVALFSILDQDSGDNGRMICSIQDNLPFFLKPTFKNFFTLVSEKALDRESQAEYNIT    351 - 420
ITVTDLGTPRLKTEYNITVLLSDVNDNAPTFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVNYSL    421 - 490
LPPQDRHLPLASLVSINADNGHLFALRSLDYEALQEFEFRVGATDRGSPALSSEALVRVLVLDANDNSPF    491 - 560
VLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLL    561 - 630
SERDAAKHRLVVLVKDNGEPPRSATATLHVLLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSSL    631 - 700
FLFSVLLFVAVRLCRRSRAASVGRCSVPEGPFPGHLVDVSGTGTLSQSYQYEVCLTGGSGTNEFKFLKPI    701 - 770
IPNFQVHDTGRNMGEIENFRNSFGLNIQ                                              771 - 798
//

Text Mined References (15)

PMID Year Title
25566775 2015 PCDHB14- and GABRB1-like nervous system developmental genes are altered during early neuronal differentiation of NCCIT cells treated with ethanol.
25416956 2014 A proteome-scale map of the human interactome network.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12231349 2002 Protocadherins.
11322959 2001 The human and murine protocadherin-beta one-exon gene families show high evolutionary conservation, despite the difference in gene number.
11230163 2001 Comparative DNA sequence analysis of mouse and human protocadherin gene clusters.
More...