Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.49
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.71407922240696E-12
group 3 medulloblastoma 2254 0.0019411473750231
atypical teratoid/rhabdoid tumor 1095 0.0148024130101784
non primary Sjogren syndrome sicca 840 0.0311329667267425
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 2.000 0.002
atypical teratoid/rhabdoid tumor 1.100 0.015
non primary Sjogren syndrome sicca -1.100 0.031
lung carcinoma 2.400 0.000

Synonym

Accession Q9Y5E6 B2R8P2 PCDH-beta-3
Symbols PCDH-BETA3

Gene

PANTHER Protein Class (2)

  Ortholog (3)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid

AA Sequence

MEAGGERFLRQRQVLLLFVFLGGSLAGSESRRYSVAEEKEKGFLIANLAKDLGLRVEELAARGAQVVSKG      1 - 70
NKQHFQLSHQTGDLLLNEKLDREELCGPTEPCILHFQILLQNPLQFVTNELRIIDVNDHSPVFFENEMHL     71 - 140
KILESTLPGTVIPLGNAEDLDVGRNSLQNYTITPNSHFHVLTRSRRDGRKYPELVLDKALDREEQPELSL    141 - 210
TLTALDGGSPPRSGTAQINIQVLDINDNAPEFAQPLYEVAVLENTPVNSVIVTVSASDLDTGSFGTISYA    211 - 280
FFHASEEIRKTFQLNPITGDMQLVKYLNFEAINSYEVDIEAKDGGGLSGKSTVIVQVVDVNDNPPELTLS    281 - 350
SVNSPIPENSGETVLAVFSVSDLDSGDNGRVMCSIENNLPFFLKPSVENFYTLVSEGALDRETRSEYNIT    351 - 420
ITITDLGTPRLKTKYNITVLVSDVNDNAPAFTQISYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSL    421 - 490
LPPQDPHLPLSSLVSINADNGHLFALRSLDYEALQAFEFRVGATDRGSPALSSEALVRVLVLDANDNSPF    491 - 560
VLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLL    561 - 630
SERDAAKHRLVVLVKDNGEPPRSATATLHVLLVDGFSQPYLPLPEAAPAQAQADLLTVYLVVALASVSSL    631 - 700
FLFSVLLFVAVRLCRRSRAASVGRCSVPEGPFPGQMVDVSGTGTLSQSYQYEVCLTGGSGTNEFKFLKPI    701 - 770
IPNFVAQGAERVSEANPSFRKSFEFS                                                771 - 796
//

Text Mined References (9)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12231349 2002 Protocadherins.
11322959 2001 The human and murine protocadherin-beta one-exon gene families show high evolutionary conservation, despite the difference in gene number.
11230163 2001 Comparative DNA sequence analysis of mouse and human protocadherin gene clusters.
10835267 2000 Phylogenetic analysis of the cadherin superfamily allows identification of six major subfamilies besides several solitary members.
10817752 2000 Cadherin superfamily genes: functions, genomic organization, and neurologic diversity.
10716726 2000 Large exons encoding multiple ectodomains are a characteristic feature of protocadherin genes.
10380929 1999 A striking organization of a large family of human neural cadherin-like cell adhesion genes.