Property Summary

NCBI Gene PubMed Count 30
PubMed Score 70.74
PubTator Score 28.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
aldosterone-producing adenoma -1.030 2.5e-02
astrocytic glioma 1.700 1.1e-02
atypical teratoid / rhabdoid tumor 2.000 1.9e-05
ependymoma 2.000 2.0e-03
glioblastoma 2.200 3.7e-04
group 4 medulloblastoma 2.100 2.0e-04
medulloblastoma, large-cell 2.900 1.5e-05
oligodendroglioma 2.300 1.7e-03
osteosarcoma 1.629 3.5e-04
pediatric high grade glioma 1.400 5.1e-03
primitive neuroectodermal tumor 1.300 6.5e-04
subependymal giant cell astrocytoma -1.498 3.9e-02

Gene RIF (14)

AA Sequence

MAVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCD      1 - 70
DKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIKESKNGKKIGVFSKD     71 - 140
KFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADE    141 - 210
KVRHSKLAESVEKAIEEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFK    211 - 280
SYCSNLVRTLMVDPSQEVQENYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGF    281 - 350
GMGIEFREGSLVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTS    351 - 420
VKKKVKNVGIFLKNEDEEEEEEEKDEAEDLLGRGSRAALLTERTRNEMTAEEKRRAHQKELAAQLNEEAK    421 - 490
RRLTEQKGEQQIQKARKSNVSYKNPSLMPKEPHIREMKIYIDKKYETVIMPVFGIATPFHIATIKNISMS    491 - 560
VEGDYTYLRINFYCPGSALGRNEGNIFPNPEATFVKEITYRASNIKAPGEQTVPALNLQNAFRIIKEVQK    561 - 630
RYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDIL    631 - 700
YNNIKHALFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDLYAEQMER    701 - 770
EMRHKLKTAFKNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSALVNATEWPPFVVTLDEV    771 - 840
ELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWLNSCDLKYTEGVQSLNWTKIMKTIV    841 - 910
DDPEGFFEQGGWSFLEPEGEGSDAEEGDSESEIEDETFNPSEDDYEEEEEDSDEDYSSEAEESDYSKESL    911 - 980
GSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKRKASVHSSGRGSNRGSRHSSAPPKKKRK       981 - 1047
//

Text Mined References (43)

PMID Year Title