Property Summary

NCBI Gene PubMed Count 28
PubMed Score 6.29
PubTator Score 5.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -1.800 2.0e-02
Astrocytoma, Pilocytic -1.800 7.7e-06
atypical teratoid / rhabdoid tumor -1.300 2.2e-02
chronic rhinosinusitis -1.302 4.9e-02
cystic fibrosis -1.016 4.3e-04
ductal carcinoma in situ 1.700 3.3e-02
ependymoma 1.200 6.0e-09
glioblastoma -1.800 3.0e-05
group 3 medulloblastoma 1.200 9.8e-03
interstitial cystitis -1.600 4.9e-03
intraductal papillary-mucinous neoplasm ... 2.300 1.4e-02
lung cancer 1.500 2.6e-04
oligodendroglioma -1.600 1.6e-09
osteosarcoma -2.730 3.5e-04
ovarian cancer -1.900 5.8e-05
pediatric high grade glioma -1.900 7.6e-04
permanent atrial fibrillation -1.400 1.3e-02
Pick disease -1.200 3.4e-02
primary pancreatic ductal adenocarcinoma 1.059 1.8e-02
primitive neuroectodermal tumor -1.100 2.5e-02
Rheumatoid arthritis -1.700 1.8e-02

Gene RIF (8)

AA Sequence

MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFS      1 - 70
RQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDH     71 - 140
QSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALFGTDGIRNAAHGPDS    141 - 210
FASAAREMELFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVN    211 - 280
VEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKI    281 - 350
QNAVHCTDLPEDGLLEVQYFFKILDN                                                351 - 376
//

Text Mined References (29)

PMID Year Title