Property Summary

NCBI Gene PubMed Count 25
PubMed Score 5.93
PubTator Score 5.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
oligodendroglioma 2849 1.56016305062798E-9
posterior fossa group B ependymoma 1530 5.46168606160589E-8
sonic hedgehog group medulloblastoma 1482 1.92956982361415E-6
pilocytic astrocytoma 3086 8.53687862737251E-6
glioblastoma 5572 3.02222648669447E-5
ovarian cancer 8492 1.45446680458177E-4
lung cancer 4473 2.58011450825781E-4
osteosarcoma 7933 3.49481439857935E-4
cystic fibrosis 1670 4.31305284603919E-4
atypical teratoid/rhabdoid tumor 1095 5.71833655482301E-4
pediatric high grade glioma 2712 7.57767324724694E-4
interstitial cystitis 2299 0.00485217215103494
permanent atrial fibrillation 44 0.0134637621470769
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0137805656998363
Rheumatoid Arthritis 1171 0.0176066030717534
primary pancreatic ductal adenocarcinoma 1271 0.0184008941592061
astrocytic glioma 2241 0.0198491886656828
primitive neuroectodermal tumor 3031 0.0247004155840688
ductal carcinoma in situ 1745 0.0330802937454139
Pick disease 1893 0.0340351853656336
chronic rhinosinusitis 512 0.0487127958009062
Disease Target Count Z-score Confidence
Thrombophlebitis 16 0.0 2.0
Disease Target Count Z-score Confidence
Primary ciliary dyskinesia 75 4.432 2.2
Hydrocephalus 60 3.364 1.7
Disease Target Count
Situs Inversus 52

Expression

Synonym

Accession Q9Y5B8 A8K3T6 A8MY09 B3KSW9 Q5TGZ4 NDK 7
Symbols NDK7
NDK 7
CFAP67
MN23H7
nm23-H7

Gene

  Ortholog (12)

Gene RIF (6)

PMID Text
24807905 NME7 functions in the gamma-tubulin ring complex in a kinase-dependent manner to facilitate microtubule nucleation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19536175 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)
17363702 Compared with wild-type betagamma nucleoside diphosphate kinase overexpression of Gbeta nucleoside diphosphate kinase suppressed basal cAMP formation up to 55%.

AA Sequence

MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFS      1 - 70
RQLVLIDYGDQYTARQLGSRKEKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDH     71 - 140
QSRPFFNELIQFITTGPIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALFGTDGIRNAAHGPDS    141 - 210
FASAAREMELFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVN    211 - 280
VEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKI    281 - 350
QNAVHCTDLPEDGLLEVQYFFKILDN                                                351 - 376
//

Text Mined References (26)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25416956 2014 A proteome-scale map of the human interactome network.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24807905 2014 NME7 is a functional component of the ?-tubulin ring complex.
22672568 2012 A genome-wide association study of venous thromboembolism identifies risk variants in chromosomes 1q24.2 and 9q.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21980494 2011 Genetics of venous thrombosis: insights from a new genome wide association study.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...