Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.47
PubTator Score 3.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Down syndrome 548
Muscle Weakness 92
Disease Target Count P-value
ovarian cancer 8492 2.91790034950716E-14
oligodendroglioma 2849 9.52431732353874E-12
atypical teratoid / rhabdoid tumor 4369 8.25629863428088E-9
malignant mesothelioma 3163 9.06558020578834E-7
osteosarcoma 7933 1.40501203367376E-6
medulloblastoma, large-cell 6234 2.34637528973462E-6
primitive neuroectodermal tumor 3031 1.06011970623946E-5
Pick disease 1893 2.2896697357058E-5
adult high grade glioma 2148 1.49931119976089E-4
group 3 medulloblastoma 2254 0.00205571608616753
astrocytic glioma 2241 0.00909809715950994
progressive supranuclear palsy 674 0.0132092771915292
glioblastoma 5572 0.0134445535497612
ependymoma 2514 0.0302442686929032
Disease Target Count Z-score Confidence
Severe congenital neutropenia 10 3.241 1.6

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
astrocytic glioma 1.500 0.009
ependymoma 1.600 0.030
glioblastoma 1.600 0.013
oligodendroglioma 1.100 0.000
osteosarcoma 2.769 0.000
group 3 medulloblastoma 1.600 0.002
atypical teratoid / rhabdoid tumor 1.700 0.000
medulloblastoma, large-cell 1.800 0.000
primitive neuroectodermal tumor 1.500 0.000
adult high grade glioma 1.100 0.000
Pick disease -1.700 0.000
progressive supranuclear palsy -1.400 0.013
ovarian cancer -2.400 0.000

Synonym

Accession Q9Y5B6 D3DSE7 Q96DU8 Q9NYQ0
Symbols GCFC
BM020
GCFC1
FSAP105
C21orf66

Gene

PANTHER Protein Class (1)

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
22174317 HIV-1 Rev interacting protein, GC-rich sequence DNA-binding factor 1 (GCFC1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
20494980 The GCFC1/C21orf66 distal promoter contains an inhibitory cis-regulatory element that is responsive to Trichostatin A (TSA) treatment according to promoter reporter assays in HEK 293 cells.

AA Sequence

MFRKARRVNVRKRNDSEEEERERDEEQEPPPLLPPPGTGEEAGPGGGDRAPGGESLLGPGPSPPSALTPG      1 - 70
LGAEAGGGFPGGAEPGNGLKPRKRPRENKEVPRASLLSFQDEEEENEEVFKVKKSSYSKKIVKLLKKEYK     71 - 140
EDLEKSKIKTELNSSAESEQPLDKTGHVKDTNQEDGVIISEHGEDEMDMESEKEEEKPKTGGAFSNALSS    141 - 210
LNVLRPGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDEDDDEKRRIVFSVKEK    211 - 280
SQRQKIAEEIGIEGSDDDALVTGEQDEELSRWEQEQIRKGINIPQVQASQPAEVNMYYQNTYQTMPYGSS    281 - 350
YGIPYSYTAYGSSDAKSQKTDNTVPFKTPSNEMTPVTIDLVKKQLKDRLDSMKELHKTNRQQHEKHLQSR    351 - 420
VDSTRAIERLEGSSGGIGERYKFLQEMRGYVQDLLECFSEKVPLINELESAIHQLYKQRASRLVQRRQDD    421 - 490
IKDESSEFSSHSNKALMAPNLDSFGRDRALYQEHAKRRIAEREARRTRRRQAREQTGKMADHLEGLSSDD    491 - 560
EETSTDITNFNLEKDRISKESGKVFEDVLESFYSIDCIKSQFEAWRSKYYTSYKDAYIGLCLPKLFNPLI    561 - 630
RLQLLTWTPLEAKCRDFENMLWFESLLFYGCEEREQEKDDVDVALLPTIVEKVILPKLTVIAENMWDPFS    631 - 700
TTQTSRMVGITLKLINGYPSVVNAENKNTQVYLKALLLRMRRTLDDDVFMPLYPKNVLENKNSGPYLFFQ    701 - 770
RQFWSSVKLLGNFLQWYGIFSNKTLQELSIDGLLNRYILMAFQNSEYGDDSIKKAQNVINCFPKQWFMNL    771 - 840
KGERTISQLENFCRYLVHLADTIYRNSIGCSDVEKRNARENIKQIVKLLASVRALDHAMSVASDHNVKEF    841 - 910
KSLIEGK                                                                   911 - 917
//

Text Mined References (24)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22862948 2012 Pax3/7BP is a Pax7- and Pax3-binding protein that regulates the proliferation of muscle precursor cells by an epigenetic mechanism.
21551269 2011 The origins, evolution, and functional potential of alternative splicing in vertebrates.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20494980 2010 Functional analysis and identification of cis-regulatory elements of human chromosome 21 gene promoters.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...