Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.14
PubTator Score 3.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.100 1.5e-04
astrocytic glioma 1.400 1.1e-02
atypical teratoid / rhabdoid tumor 1.700 8.3e-09
ependymoma 1.600 3.0e-02
glioblastoma 1.200 3.1e-06
group 3 medulloblastoma 1.600 2.1e-03
malignant mesothelioma 1.300 9.1e-07
medulloblastoma, large-cell 1.800 2.3e-06
oligodendroglioma 1.100 9.5e-12
osteosarcoma 2.769 1.4e-06
ovarian cancer -2.400 2.9e-14
Pick disease -1.700 2.3e-05
primitive neuroectodermal tumor 1.500 1.1e-05
progressive supranuclear palsy -1.400 1.3e-02

Gene RIF (2)

AA Sequence

MFRKARRVNVRKRNDSEEEERERDEEQEPPPLLPPPGTGEEAGPGGGDRAPGGESLLGPGPSPPSALTPG      1 - 70
LGAEAGGGFPGGAEPGNGLKPRKRPRENKEVPRASLLSFQDEEEENEEVFKVKKSSYSKKIVKLLKKEYK     71 - 140
EDLEKSKIKTELNSSAESEQPLDKTGHVKDTNQEDGVIISEHGEDEMDMESEKEEEKPKTGGAFSNALSS    141 - 210
LNVLRPGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDEDDDEKRRIVFSVKEK    211 - 280
SQRQKIAEEIGIEGSDDDALVTGEQDEELSRWEQEQIRKGINIPQVQASQPAEVNMYYQNTYQTMPYGSS    281 - 350
YGIPYSYTAYGSSDAKSQKTDNTVPFKTPSNEMTPVTIDLVKKQLKDRLDSMKELHKTNRQQHEKHLQSR    351 - 420
VDSTRAIERLEGSSGGIGERYKFLQEMRGYVQDLLECFSEKVPLINELESAIHQLYKQRASRLVQRRQDD    421 - 490
IKDESSEFSSHSNKALMAPNLDSFGRDRALYQEHAKRRIAEREARRTRRRQAREQTGKMADHLEGLSSDD    491 - 560
EETSTDITNFNLEKDRISKESGKVFEDVLESFYSIDCIKSQFEAWRSKYYTSYKDAYIGLCLPKLFNPLI    561 - 630
RLQLLTWTPLEAKCRDFENMLWFESLLFYGCEEREQEKDDVDVALLPTIVEKVILPKLTVIAENMWDPFS    631 - 700
TTQTSRMVGITLKLINGYPSVVNAENKNTQVYLKALLLRMRRTLDDDVFMPLYPKNVLENKNSGPYLFFQ    701 - 770
RQFWSSVKLLGNFLQWYGIFSNKTLQELSIDGLLNRYILMAFQNSEYGDDSIKKAQNVINCFPKQWFMNL    771 - 840
KGERTISQLENFCRYLVHLADTIYRNSIGCSDVEKRNARENIKQIVKLLASVRALDHAMSVASDHNVKEF    841 - 910
KSLIEGK                                                                   911 - 917
//

Text Mined References (26)

PMID Year Title