Property Summary

NCBI Gene PubMed Count 36
PubMed Score 81.92
PubTator Score 14.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.100 1.4e-06

Gene RIF (23)

PMID Text
26590573 results demonstrated that CTDP1 was upregulated in human lung cancer tissues. In addition, it implied that CTDP1 played an important role in cell proliferation and may be a useful therapeutic target in human lung cancer.
22692537 Data propose that Fcp1 has a crucial role in the liaison between dephosphorylation and ubiquitination that drives mitosis exit.
21672523 although FCP1 is intrinsically disordered, the above 16 residues composing the RAP74 binding surface form nascent alpha-helical structure in the unbound state.
19888685 NMR assignments for C terminal region
19215094 NMR and thermodynamic studies further elucidate the complex molecular mechanism by which TFIIF and FCP1 cooperate for RNAPII recycling.
18854154 Knockdown of CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, subunit 1 (CTDP1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18294453 These data suggest that icariin exerts its potent osteogenic effect through induction of Runx2 expression, production of BMP-4 and activation of BMP signaling.
18187620 FCP1 is required for Tat-mediated transactivation in vitro and amino acids 562-685 of FCP1 are necessary for binding to Tat in yeast two-hybrid studies
18187620 Knockdown of CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, subunit 1 (CTDP1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
15723517 Enhanced binding to RAP74 following phosphorylation.
15723517 FCP1 is required for Tat-mediated transactivation in vitro and amino acids 562-685 of FCP1 are necessary for binding to Tat in yeast two-hybrid studies
15670829 found that FCP1 is a genuine substrate of PRMT5-methylation both in vivo and in vitro, and FCP1-associated PRMT5 can methylate histones H4 in vitro
14517542 Congenital cataracts facial dysmorphism neuropathy is caused by a single-nucleotide substitution in an antisense Alu element in intron 6 of CTDP1, resulting in a rare mechanism of aberrant splicing and an Alu insertion in the processed mRNA
12732728 high-resolution solution structure of a cterRAP74cterFCP complex by NMR spectroscopy
12591941 cocrystal structure of the winged-helix domain of human RNA polymerase II-associating protein 74 bound to the alpha-helical C terminus of human FCP1
12591939 FCP1 kinase from HeLa cells is phosphorylated and affects transcription elongation
12578358 FCP1 binds to a groove of RAP74 between alpha-helices H2 and H3, without affecting the secondary structure of RAP74 C-terminal domain; FCP1 binds also to a groove of TFIIB core domain beween alpha helices D1 and E1 in the first cyclin repeat.
12370301 FCP1 is important for transcription elongation along with TFIIF
12036313 FCP1 augments tat transactivation of the HIV-1 long-terminal repeat
11273209 FCP1 is required for Tat-mediated transactivation in vitro and amino acids 562-685 of FCP1 are necessary for binding to Tat in yeast two-hybrid studies
10938286 FCP1 is required for Tat-mediated transactivation in vitro and amino acids 562-685 of FCP1 are necessary for binding to Tat in yeast two-hybrid studies
9822634 FCP1 is required for Tat-mediated transactivation in vitro and amino acids 562-685 of FCP1 are necessary for binding to Tat in yeast two-hybrid studies
9765293 FCP1 is required for Tat-mediated transactivation in vitro and amino acids 562-685 of FCP1 are necessary for binding to Tat in yeast two-hybrid studies

AA Sequence

MEVPAAGRVPAEGAPTAAVAEVRCPGPAPLRLLEWRVAAGAAVRIGSVLAVFEAAASAQSSGASQSRVAS      1 - 70
GGCVRPARPERRLRSERAGVVRELCAQPGQVVAPGAVLVRLEGCSHPVVMKGLCAECGQDLTQLQSKNGK     71 - 140
QQVPLSTATVSMVHSVPELMVSSEQAEQLGREDQQRLHRNRKLVLMVDLDQTLIHTTEQHCQQMSNKGIF    141 - 210
HFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDP    211 - 280
FSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFQGTGDMNAPPGSRESQTRKKVNHSRGT    281 - 350
EVSEPSPPVRDPEGVTQAPGVEPSNGLEKPARELNGSEAATPRDSPRPGKPDERDIWPPAQAPTSSQELA    351 - 420
GAPEPQGSCAQGGRVAPGQRPAQGATGTDLDFDLSSDSESSSESEGTKSSSSASDGESEGKRGRQKPKAA    421 - 490
PEGAGALAQGSSLEPGRPAAPSLPGEAEPGAHAPDKEPELGGQEEGERDGLCGLGNGCADRKEAETESQN    491 - 560
SELSGVTAGESLDQSMEEEEEEDTDEDDHLIYLEEILVRVHTDYYAKYDRYLNKEIEEAPDIRKIVPELK    561 - 630
SKVLADVAIIFSGLHPTNFPIEKTREHYHATALGAKILTRLVLSPDAPDRATHLIAARAGTEKVLQAQEC    631 - 700
GHLHVVNPDWLWSCLERWDKVEEQLFPLRDDHTKAQRENSPAAFPDREGVPPTALFHPMPVLPKAQPGPE    701 - 770
VRIYDSNTGKLIRTGARGPPAPSSSLPIRQEPSSFRAVPPPQPQMFGEELPDAQDGEQPGPSRRKRQPSM    771 - 840
SETMPLYTLCKEDLESMDKEVDDILGEGSDDSDSEKRRPEEQEEEPQPRKPGTRRERTLGAPASSERSAA    841 - 910
GGRGPRGHKRKLNEEDAASESSRESSNEDEGSSSEADEMAKALEAELNDLM                       911 - 961
//

Text Mined References (44)

PMID Year Title
26653855 2015 Fcp1 phosphatase controls Greatwall kinase to promote PP2A-B55 activation and mitotic progression.
26590573 2016 Lentivirus-mediated knockdown of CTDP1 inhibits lung cancer cell growth in vitro.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23212062 2012 Genome-wide association study of clinical dimensions of schizophrenia: polygenic effect on disorganized symptoms.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22692537 2012 Fcp1-dependent dephosphorylation is required for M-phase-promoting factor inactivation at mitosis exit.
21672523 2011 The disordered C-terminus of the RNA polymerase II phosphatase FCP1 is partially helical in the unbound state.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19888685 2009 NMR assignment of the intrinsically disordered C-terminal region of Homo sapiens FCP1 in the unbound state.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19215094 2009 NMR structure of a complex formed by the carboxyl-terminal domain of human RAP74 and a phosphorylated peptide from the central domain of the FCP1 phosphatase.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18294453 2008 Human phosphorylated CTD-interacting protein, PCIF1, negatively modulates gene expression by RNA polymerase II.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15723517 2005 Interactions of the HIV-1 Tat and RAP74 proteins with the RNA polymerase II CTD phosphatase FCP1.
15670829 2005 Identification of proteins interacting with the RNAPII FCP1 phosphatase: FCP1 forms a complex with arginine methyltransferase PRMT5 and it is a substrate for PRMT5-mediated methylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14576433 2003 The BRCT domain is a phospho-protein binding domain.
14517542 2003 Partial deficiency of the C-terminal-domain phosphatase of RNA polymerase II is associated with congenital cataracts facial dysmorphism neuropathy syndrome.
12732728 2003 NMR structure of a complex containing the TFIIF subunit RAP74 and the RNA polymerase II carboxyl-terminal domain phosphatase FCP1.
12721286 2003 A novel RNA polymerase II C-terminal domain phosphatase that preferentially dephosphorylates serine 5.
12676794 2003 The RNA polymerase II elongation complex.
12591941 2003 Molecular mechanism of recruitment of TFIIF- associating RNA polymerase C-terminal domain phosphatase (FCP1) by transcription factor IIF.
12591939 2003 The C-terminal domain phosphatase and transcription elongation activities of FCP1 are regulated by phosphorylation.
12578358 2003 Solution structure of the carboxyl-terminal domain of RAP74 and NMR characterization of the FCP1-binding sites of RAP74 and human TFIIB.
12560496 2003 The FCP1 phosphatase interacts with RNA polymerase II and with MEP50 a component of the methylosome complex involved in the assembly of snRNP.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370301 2002 FCP1, a phosphatase specific for the heptapeptide repeat of the largest subunit of RNA polymerase II, stimulates transcription elongation.
12185079 2002 Protein phosphatase-1 dephosphorylates the C-terminal domain of RNA polymerase-II.
11273209 2001 Inhibition of Tat transactivation by the RNA polymerase II CTD-phosphatase FCP1.
10938286 2000 C-terminal domain phosphatase sensitivity of RNA polymerase II in early elongation complexes on the HIV-1 and adenovirus 2 major late templates.
10439962 1999 Congenital cataracts facial dysmorphism neuropathy (CCFDN) syndrome: a novel developmental disorder in Gypsies maps to 18qter.
10385623 1999 A protein phosphatase functions to recycle RNA polymerase II.
9822634 1998 Regulation of carboxyl-terminal domain phosphatase by HIV-1 tat protein.
9765293 1998 FCP1, the RAP74-interacting subunit of a human protein phosphatase that dephosphorylates the carboxyl-terminal domain of RNA polymerase IIO.
9405607 1997 An essential component of a C-terminal domain phosphatase that interacts with transcription factor IIF in Saccharomyces cerevisiae.