Property Summary

NCBI Gene PubMed Count 36
Grant Count 27
R01 Count 27
Funding $2,725,642.92
PubMed Score 81.92
PubTator Score 14.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.100 0.000

Gene RIF (23)

PMID Text
26590573 results demonstrated that CTDP1 was upregulated in human lung cancer tissues. In addition, it implied that CTDP1 played an important role in cell proliferation and may be a useful therapeutic target in human lung cancer.
22692537 Data propose that Fcp1 has a crucial role in the liaison between dephosphorylation and ubiquitination that drives mitosis exit.
21672523 although FCP1 is intrinsically disordered, the above 16 residues composing the RAP74 binding surface form nascent alpha-helical structure in the unbound state.
19888685 NMR assignments for C terminal region
19215094 NMR and thermodynamic studies further elucidate the complex molecular mechanism by which TFIIF and FCP1 cooperate for RNAPII recycling.
18854154 Knockdown of CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, subunit 1 (CTDP1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18294453 These data suggest that icariin exerts its potent osteogenic effect through induction of Runx2 expression, production of BMP-4 and activation of BMP signaling.
18187620 FCP1 is required for Tat-mediated transactivation in vitro and amino acids 562-685 of FCP1 are necessary for binding to Tat in yeast two-hybrid studies
18187620 Knockdown of CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, subunit 1 (CTDP1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
15723517 Enhanced binding to RAP74 following phosphorylation.
More...

AA Sequence

MEVPAAGRVPAEGAPTAAVAEVRCPGPAPLRLLEWRVAAGAAVRIGSVLAVFEAAASAQSSGASQSRVAS      1 - 70
GGCVRPARPERRLRSERAGVVRELCAQPGQVVAPGAVLVRLEGCSHPVVMKGLCAECGQDLTQLQSKNGK     71 - 140
QQVPLSTATVSMVHSVPELMVSSEQAEQLGREDQQRLHRNRKLVLMVDLDQTLIHTTEQHCQQMSNKGIF    141 - 210
HFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDP    211 - 280
FSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFQGTGDMNAPPGSRESQTRKKVNHSRGT    281 - 350
EVSEPSPPVRDPEGVTQAPGVEPSNGLEKPARELNGSEAATPRDSPRPGKPDERDIWPPAQAPTSSQELA    351 - 420
GAPEPQGSCAQGGRVAPGQRPAQGATGTDLDFDLSSDSESSSESEGTKSSSSASDGESEGKRGRQKPKAA    421 - 490
PEGAGALAQGSSLEPGRPAAPSLPGEAEPGAHAPDKEPELGGQEEGERDGLCGLGNGCADRKEAETESQN    491 - 560
SELSGVTAGESLDQSMEEEEEEDTDEDDHLIYLEEILVRVHTDYYAKYDRYLNKEIEEAPDIRKIVPELK    561 - 630
SKVLADVAIIFSGLHPTNFPIEKTREHYHATALGAKILTRLVLSPDAPDRATHLIAARAGTEKVLQAQEC    631 - 700
GHLHVVNPDWLWSCLERWDKVEEQLFPLRDDHTKAQRENSPAAFPDREGVPPTALFHPMPVLPKAQPGPE    701 - 770
VRIYDSNTGKLIRTGARGPPAPSSSLPIRQEPSSFRAVPPPQPQMFGEELPDAQDGEQPGPSRRKRQPSM    771 - 840
SETMPLYTLCKEDLESMDKEVDDILGEGSDDSDSEKRRPEEQEEEPQPRKPGTRRERTLGAPASSERSAA    841 - 910
GGRGPRGHKRKLNEEDAASESSRESSNEDEGSSSEADEMAKALEAELNDLM                       911 - 961
//

Text Mined References (44)

PMID Year Title
26653855 2015 Fcp1 phosphatase controls Greatwall kinase to promote PP2A-B55 activation and mitotic progression.
26590573 2016 Lentivirus-mediated knockdown of CTDP1 inhibits lung cancer cell growth in vitro.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23212062 2012 Genome-wide association study of clinical dimensions of schizophrenia: polygenic effect on disorganized symptoms.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22692537 2012 Fcp1-dependent dephosphorylation is required for M-phase-promoting factor inactivation at mitosis exit.
21672523 2011 The disordered C-terminus of the RNA polymerase II phosphatase FCP1 is partially helical in the unbound state.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...