Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.68
PubTator Score 11.08

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y5A9 A6NKG4 A8K966 B4E1G7 D3DPM8 Q5VSZ9 Q8TDH0 Q9BUJ5
Symbols CAHL
HGRG8
NY-REN-2

Gene

PDB

4RDN   4RDO   4WQN  

Gene RIF (7)

PMID Text
26318451 binding affinities of the YTH domains of three human proteins and yeast YTH domain protein Pho92
25412661 The basic residues K416 and R527 on the surface of the YTH domain of YTHDF2 are involved in binding to the RNA backbone, and residues W432 and W486 within the hydrophobic pocket contribute to the specific recognition of N6-methyladenosine.
25412658 The study presents the structure of YTH-YTHDF2 in complex with an N6-methyladenosine mononucleotide.
24284625 m(6)A is selectively recognized by the human YTH domain family 2 (YTHDF2) 'reader' protein to regulate mRNA degradation
16799135 Observational study of gene-disease association. (HuGE Navigator)
16799135 YTHDF2 messenger RNA resulted to be mainly expressed in testis and placenta. The data suggest a possible role of this locus in human longevity.
10508479 PMID:10508479 reported that AF155095 (clone REN-2) may be involved in signal transduction and the gene is on chromosome 14. It turns out that it is the pseudogene, not the real gene, is located on chromosome 14.

AA Sequence

MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSL      1 - 70
GEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQ     71 - 140
GQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASNVPKVVGSA    141 - 210
VGSGSITSNIVASNSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDN    211 - 280
KGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTR    281 - 350
WVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSE    351 - 420
DDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDK    421 - 490
WKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHY    491 - 560
EKRQEEEESVKKERQGRGK                                                       561 - 579
//

Publication (31)

PMID Year Title
26458103 2015 Dynamic m(6)A mRNA methylation directs translational control of heat shock response.
26318451 2015 Structural Basis for the Discriminative Recognition of N6-Methyladenosine RNA by the Human YT521-B Homology Domain Family of Proteins.
26046440 2015 N(6)-methyladenosine Modulates Messenger RNA Translation Efficiency.
25412661 2014 Crystal structure of the YTH domain of YTHDF2 reveals mechanism for recognition of N6-methyladenosine.
25412658 2014 Structure of the YTH domain of human YTHDF2 in complex with an m(6)A mononucleotide reveals an aromatic cage for m(6)A recognition.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24284625 2014 N6-methyladenosine-dependent regulation of messenger RNA stability.
24206186 2014 A novel protein, Pho92, has a conserved YTH domain and regulates phosphate metabolism by decreasing the mRNA stability of PHO4 in Saccharomyces cerevisiae.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...