Property Summary

NCBI Gene PubMed Count 40
PubMed Score 65.25
PubTator Score 47.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
juvenile dermatomyositis 1187 1.3e-13
tuberculosis 2010 1.4e-04
ovarian cancer 8520 1.0e-03
osteosarcoma 7950 1.2e-03
Disease Target Count Z-score Confidence
Leber congenital amaurosis 69 4.227 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
juvenile dermatomyositis 1.084 1.3e-13
osteosarcoma -1.271 1.2e-03
ovarian cancer -1.300 1.0e-03
tuberculosis 1.100 1.4e-04

Gene RIF (18)

AA Sequence

MAQKKYLQAKLTQFLREDRIQLWKPPYTDENKKVGLALKDLAKQYSDRLECCENEVEKVIEEIRCKAIER      1 - 70
GTGNDNYRTTGIATIEVFLPPRLKKDRKNLLETRLHITGRELRSKIAETFGLQENYIKIVINKKQLQLGK     71 - 140
TLEEQGVAHNVKAMVLELKQSEEDARKNFQLEEEEQNEAKLKEKQIQRTKRGLEILAKRAAETVVDPEMT    141 - 210
PYLDIANQTGRSIRIPPSERKALMLAMGYHEKGRAFLKRKEYGIALPCLLDADKYFCECCRELLDTVDNY    211 - 280
AVLQLDIVWCYFRLEQLECLDDAEKKLNLAQKCFKNCYGENHQRLVHIKGNCGKEKVLFLRLYLLQGIRN    281 - 350
YHSGNDVEAYEYLNKARQLFKELYIDPSKVDNLLQLGFTAQEARLGLRACDGNVDHAATHITNRREELAQ    351 - 420
IRKEEKEKKRRRLENIRFLKGMGYSTHAAQQVLHAASGNLDEALKILLSNPQMWWLNDSNPETDNRQESP    421 - 490
SQENIDRLVYMGFDALVAEAALRVFRGNVQLAAQTLAHNGGSLPPELPLSPEDSLSPPATSPSDSAGTSS    491 - 560
ASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEEIIIAEYLSYVENRKSATKKN                   561 - 615
//

Text Mined References (42)

PMID Year Title