Property Summary

NCBI Gene PubMed Count 37
Grant Count 7
R01 Count 6
Funding $389,175.05
PubMed Score 61.79
PubTator Score 47.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.886 0.000
juvenile dermatomyositis 1.084 0.000
tuberculosis and treatment for 6 months 1.300 0.000
ovarian cancer 1.600 0.001

Gene RIF (16)

PMID Text
26260793 NUB1L suppresses atypical neddylation and promotes the degradation of misfolded proteins by the proteasome
25505242 The interaction of HIV-1 CA with human cellular negative regulator of ubiquitin-like protein 1 (NUB1) is identified by yeast two-hybrid screen
24100225 Based on biochemical features of the VBM motifs, we also identified NUB1L (NEDD8 ultimate buster-1 long) as a novel VBM-containing protein, which is involved in proteasomal degradation of NEDD8 through the P97 pathway.
24019527 In coordination with the P97-UFD1-NPL4 complex (P97(UFD1/NPL4)), NUB1L promotes transfer of NEDD8 to proteasome for degradation.
23525043 This study identified genes modifying endogenous mHTT using high-throughput screening and demonstrate NUB1 as an exemplar entry point for therapeutic intervention of Huntington's disease.
22965877 Data propose that NUB1, by regulating GSK3beta levels, modulates tau phosphorylation and aggregation, and is a key player in neurodegeneration associated with tau pathology.
22612509 In the present study, the proportions of intranuclear inclusion positive for NEDD8, NUB1 and SUMO-1 were significantly lower in glial cells than in neurons.
22434192 findings show how FAT10 and NUB1L dock with the 26S proteasome to initiate proteolysis; identified the 26S proteasome subunit hRpn10/S5a as the receptor for FAT10, whereas NUB1L can bind to both Rpn10 and Rpn1/S2.
21937912 The finding of this study suggested that NUB1 along with abnormal alpha-synuclein is involved in the pathogenesis of Lewy body disease.
16877356 These results suggest that NUB1 indeed targets synphilin-1 to the proteasome for its efficient degradation, which, because of the resultant reduction in synphilin-1, suppresses the formation of synphilin-1-positive inclusions.
More...

AA Sequence

MAQKKYLQAKLTQFLREDRIQLWKPPYTDENKKVGLALKDLAKQYSDRLECCENEVEKVIEEIRCKAIER      1 - 70
GTGNDNYRTTGIATIEVFLPPRLKKDRKNLLETRLHITGRELRSKIAETFGLQENYIKIVINKKQLQLGK     71 - 140
TLEEQGVAHNVKAMVLELKQSEEDARKNFQLEEEEQNEAKLKEKQIQRTKRGLEILAKRAAETVVDPEMT    141 - 210
PYLDIANQTGRSIRIPPSERKALMLAMGYHEKGRAFLKRKEYGIALPCLLDADKYFCECCRELLDTVDNY    211 - 280
AVLQLDIVWCYFRLEQLECLDDAEKKLNLAQKCFKNCYGENHQRLVHIKGNCGKEKVLFLRLYLLQGIRN    281 - 350
YHSGNDVEAYEYLNKARQLFKELYIDPSKVDNLLQLGFTAQEARLGLRACDGNVDHAATHITNRREELAQ    351 - 420
IRKEEKEKKRRRLENIRFLKGMGYSTHAAQQVLHAASGNLDEALKILLSNPQMWWLNDSNPETDNRQESP    421 - 490
SQENIDRLVYMGFDALVAEAALRVFRGNVQLAAQTLAHNGGSLPPELPLSPEDSLSPPATSPSDSAGTSS    491 - 560
ASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEEIIIAEYLSYVENRKSATKKN                   561 - 615
//

Text Mined References (39)

PMID Year Title
26260793 2015 NEDD8 Ultimate Buster 1 Long (NUB1L) Protein Suppresses Atypical Neddylation and Promotes the Proteasomal Degradation of Misfolded Proteins.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24100225 2013 Structural and mechanistic insights into the arginine/lysine-rich peptide motifs that interact with P97/VCP.
24019527 2013 NEDD8 ultimate buster-1 long (NUB1L) protein promotes transfer of NEDD8 to proteasome for degradation through the P97UFD1/NPL4 complex.
23525043 2013 Identification of NUB1 as a suppressor of mutant Huntington toxicity via enhanced protein clearance.
22965877 2012 NUB1 modulation of GSK3? reduces tau aggregation.
22612509 2012 Ubiquitin-related proteins in neuronal and glial intranuclear inclusions in intranuclear inclusion body disease.
22434192 2012 FAT10 and NUB1L bind to the VWA domain of Rpn10 and Rpn1 to enable proteasome-mediated proteolysis.
21937912 2011 Synphilin-1-binding protein NUB1 is colocalized with nonfibrillar, proteinase K-resistant ?-synuclein in presynapses in Lewy body disease.
More...