Property Summary

NCBI Gene PubMed Count 10
Grant Count 4
Funding $49,650.78
PubMed Score 4.60
PubTator Score 2.18

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.073 0.000
pancreatic ductal adenocarcinoma liver m... -1.065 0.005
group 3 medulloblastoma 1.200 0.001

Gene RIF (1)

PMID Text
16540086 This result indicates that NY-REN-21 can function either as a homodimer or as a heterodimer with SCAND1.

AA Sequence

MMTKVLGMAPVLGPRPPQEQVGPLMVKVEEKEEKGKYLPSLEMFRQRFRQFGYHDTPGPREALSQLRVLC      1 - 70
CEWLRPEIHTKEQILELLVLEQFLTILPQELQAWVQEHCPESAEEAVTLLEDLERELDEPGHQVSTPPNE     71 - 140
QKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESAD    141 - 210
EQKGSEAEGLKGDIISVIIANKPEASLERQCVNLENEKGTKPPLQEAGSKKGRESVPTKPTPGERRYICA    211 - 280
ECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKH    281 - 350
QRMHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQRLHTGEKPYKCKE    351 - 420
CGKAFNHSSNFNKHHRIHTGEKPYWCHHCGKTFCSKSNLSKHQRVHTGEGEAP                     421 - 473
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19549071 2009 Functional dissection of the alpha-synuclein promoter: transcriptional regulation by ZSCAN21 and ZNF219.
16540086 2006 Spectroscopic characterization of the tumor antigen NY-REN-21 and identification of heterodimer formation with SCAND1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
7486829 1995 Chromosomal localization of two KOX zinc finger genes on chromosome bands 7q21-q22.
2014798 1991 Twenty-seven nonoverlapping zinc finger cDNAs from human T cells map to nine different chromosomes with apparent clustering.