Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.05
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis -1.200 0.000
astrocytoma 1.100 0.000
oligodendroglioma 1.100 0.000
medulloblastoma, large-cell 1.200 0.001
tuberculosis 1.200 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.046
lung cancer 1.300 0.000
diabetes mellitus -1.100 0.001
pediatric high grade glioma 1.100 0.000
pilocytic astrocytoma 1.200 0.000
aldosterone-producing adenoma -1.435 0.022
lung adenocarcinoma -1.200 0.000
nasopharyngeal carcinoma 1.300 0.000
spina bifida -1.836 0.041
ovarian cancer 2.300 0.000

Gene RIF (1)

PMID Text
23382386 KCTD3 is an accessory subunit of native HCN3 complexes

AA Sequence

MAGGHCGSFPAAAAGSGEIVQLNVGGTRFSTSRQTLMWIPDSFFSSLLSGRISTLRDETGAIFIDRDPAA      1 - 70
FAPILNFLRTKELDLRGVSINVLRHEAEFYGITPLVRRLLLCEELERSSCGSVLFHGYLPPPGIPSRKIN     71 - 140
NTVRSADSRNGLNSTEGEARGNGTQPVLSGTGEETVRLGFPVDPRKVLIVAGHHNWIVAAYAHFAVCYRI    141 - 210
KESSGWQQVFTSPYLDWTIERVALNAKVVGGPHGDKDKMVAVASESSIILWSVQDGGSGSEIGVFSLGVP    211 - 280
VDALFFIGNQLVATSHTGKVGVWNAVTQHWQVQDVVPITSYDTAGSFLLLGCNNGSIYYIDMQKFPLRMK    281 - 350
DNDLLVTELYHDPSNDAITALSVYLTPKTSVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVH    351 - 420
RSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLEETESHGSYSSGNDIGP    421 - 490
FGERDDQQVFIQKVVPITNKLFVRLSSTGKRICEIQAVDCTTISSFTVRECEGSSRMGSRPRRYLFTGHT    491 - 560
NGSIQMWDLTTAMDMVNKSEDKDVGGPTEEELLKLLDQCDLSTSRCATPNISPATSVVQHSHLRESNSSL    561 - 630
QLQHHDTTHEAATYGSMRPYRESPLLARARRTESFHSYRDFQTINLNRNVERAVPENGNLGPIQAEVKGA    631 - 700
TGECNISERKSPGVEIKSLRELDSGLEVHKIAEGFSESKKRSSEDENENKIEFRKKGGFEGGGFLGRKKV    701 - 770
PYLASSPSTSDGGTDSPGTASPSPTKTTPSPRHKKSDSSGQEYSL                             771 - 815
//

Publication (14)

PMID Year Title
25558065 2015 Accelerating novel candidate gene discovery in neurogenetic disorders via whole-exome sequencing of prescreened multiplex consanguineous families.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382386 2013 Up-regulation of hyperpolarization-activated cyclic nucleotide-gated channel 3 (HCN3) by specific interaction with K+ channel tetramerization domain-containing protein 3 (KCTD3).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19582487 2010 Disruption of CNTNAP2 and additional structural genome changes in a boy with speech delay and autism spectrum disorder.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...