Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.42
PubTator Score 2.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
SPASTIC PARAPLEGIA 52, AUTOSOMAL RECESSIVE 1 0.0 0.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
hereditary spastic paraplegia 318 0.0 4.0
Disease Target Count
hereditary spastic paraplegia 52 2

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.300 2.3e-03
astrocytic glioma -1.200 3.2e-02
atypical teratoid / rhabdoid tumor -1.800 7.0e-08
colon cancer -1.300 4.1e-02
ependymoma -1.400 4.4e-02
glioblastoma -1.100 2.9e-04
group 4 medulloblastoma -1.100 6.8e-03
malignant mesothelioma -1.200 3.7e-06
medulloblastoma, large-cell -2.000 2.7e-06
oligodendroglioma -1.200 3.5e-02
osteosarcoma -1.304 3.0e-05
ovarian cancer -1.100 6.1e-04
primitive neuroectodermal tumor -1.100 1.3e-02
subependymal giant cell astrocytoma -1.155 2.4e-02

Gene RIF (2)

AA Sequence

MIKFFLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLSRSNEQCSFIEYKDFKLIYRQYAALFIVVG      1 - 70
VNDTENEMAIYEFIHNFVEVLDEYFSRVSELDIMFNLDKVHIILDEMVLNGCIVETNRARILAPLLILDK     71 - 140
MSES                                                                      141 - 144
//

Text Mined References (9)

PMID Year Title