Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.89
PubTator Score 0.50

Knowledge Summary

Patent (396)

Gene RIF (2)

PMID Text
23903073 We identified and confirmed a novel region on OR1A2 associated with Neuroticism.
17601748 Evolutionary conserved amino acid residues to be necessary for specific responsiveness of OR1A1 to odorants were identified.

AA Sequence

MKKENQSFNLDFILLGVTSQQEQNNVFFVIFLCIYPITLTGNLLIILAICADIRLHNPMYFLLANLSLVD      1 - 70
IIFSSVTIPKVLANHLLGSKFISFGGCLMQMYFMIALAKADSYTLAAMAYDRAVAISCPLHYTTIMSPRS     71 - 140
CILLIAGSWVIGNTSALPHTLLTASLSFCGNQEVANFYCDIMPLLKLSCSDVHFNVKMMYLGVGVFSLPL    141 - 210
LCIIVSYVQVFSTVFQVPSTKSLFKAFCTCGSHLTVVFLYYGTTMGMYFRPLTSYSPKDAVITVMYVAVT    211 - 280
PALNPFIYSLRNWDMKAALQKLFSKRISS                                             281 - 309
//

Publication (7)

PMID Year Title
23903073 2013 Genome-wide association study of the five-factor model of personality in young Korean women.
17601748 2007 Structural determinants of odorant recognition by the human olfactory receptors OR1A1 and OR1A2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.