Property Summary

NCBI Gene PubMed Count 9
Grant Count 11
R01 Count 9
Funding $921,373.85
PubMed Score 4.67
PubTator Score 18.46

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -1.154 0.000
pulmonary arterial hypertension -1.100 0.035
ovarian cancer -1.100 0.000

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
14726512 in contrast to yeast, only a small fraction of Tim9-Tim10a-Tim10b complex is in a stable association with Tim22.

AA Sequence

MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCA      1 - 70
FKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTE     71 - 140
CLIESYRGTSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR                    141 - 194
//

Publication (11)

PMID Year Title
27718247 2016 TIM29 is a subunit of the human carrier translocase required for protein transport.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14726512 2004 Organization and function of the small Tim complexes acting along the import pathway of metabolite carriers into mammalian mitochondria.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11864609 2002 Tim22, the essential core of the mitochondrial protein insertion complex, forms a voltage-activated and signal-gated channel.
10611480 1999 The mitochondrial TIM22 preprotein translocase is highly conserved throughout the eukaryotic kingdom.
More...