Property Summary

NCBI Gene PubMed Count 6
Grant Count 4
Funding $71,060
PubMed Score 12.25
PubTator Score 9.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

AA Sequence

MPRLLRLSLLWLGLLLVRFSRELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASE      1 - 70
KVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVY     71 - 140
IHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDFKRLKEKRSSLVT    141 - 210
KIY                                                                       211 - 213
//

Text Mined References (6)

PMID Year Title
19915573 2009 A genome-wide association study identifies three new susceptibility loci for ulcerative colitis in the Japanese population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10819760 2000 Identification of INSL6, a new member of the insulin family that is expressed in the testis of the human and rat.
10598589 1999 Cloning of two novel mammalian paralogs of relaxin/insulin family proteins and their expression in testis and kidney.