Property Summary

NCBI Gene PubMed Count 6
PubMed Score 12.25
PubTator Score 9.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cryptorchidism 296 3.923 2.0
Male infertility 206 3.28 1.6
Situs Inversus 65 3.213 1.6

Expression

AA Sequence

MPRLLRLSLLWLGLLLVRFSRELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASE      1 - 70
KVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVY     71 - 140
IHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDFKRLKEKRSSLVT    141 - 210
KIY                                                                       211 - 213
//

Text Mined References (6)

PMID Year Title