Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.57
PubTator Score 2.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
non-small cell lung carcinoma 413
Disease Target Count P-value
posterior fossa group A ependymoma 1511 3.86828283710501E-9
ovarian cancer 8492 1.38077640929284E-4
osteosarcoma 7933 0.00180686865906033
group 3 medulloblastoma 2254 0.00348001868923693
glioblastoma 5572 0.0090699765106472
Disease Target Count Z-score Confidence
Pontocerebellar hypoplasia 29 4.421 2.2

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.140 0.002
posterior fossa group A ependymoma 1.500 0.000
glioblastoma 1.200 0.009
group 3 medulloblastoma 1.300 0.003
ovarian cancer -1.400 0.000

Synonym

Accession Q9Y580 B2R6K8 Q9NUT4
Symbols

Gene

PANTHER Protein Class (1)

PDB

2M8H   5IQQ  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (2)

PMID Text
25525152 Phosphorylation of RBM7 by the p38(MAPK)/MK2 axis increases nuclear ncRNA stability by blocking their RBM7-binding and subsequent RNA exosome targeting to allow stress-dependent modulations of the noncoding transcriptome.
18854154 Knockdown of RNA binding motif protein 7 (RBM7) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLL      1 - 70
NGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERTMDNMTSSAQIIQRSFSSPEN     71 - 140
FQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQWRQGTPSSQRKVRMNSYPYLAD    141 - 210
RHYSREQRYTDHGSDHHYRGKRDDFFYEDRNHDDWSHDYDNRRDSSRDGKWRSSRH                  211 - 266
//

Text Mined References (21)

PMID Year Title
25852104 2015 RBM7 subunit of the NEXT complex binds U-rich sequences and targets 3'-end extended forms of snRNAs.
25525152 2015 p38MAPK/MK2-mediated phosphorylation of RBM7 regulates the human nuclear exosome targeting complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...