Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.57
PubTator Score 2.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.140 0.002
posterior fossa group A ependymoma 1.500 0.000
glioblastoma 1.200 0.009
group 3 medulloblastoma 1.300 0.003
ovarian cancer -1.400 0.000

Synonym

Accession Q9Y580 B2R6K8 Q9NUT4
Symbols

Gene

PANTHER Protein Class (1)

PDB

2M8H   5IQQ  

Gene RIF (2)

PMID Text
25525152 Phosphorylation of RBM7 by the p38(MAPK)/MK2 axis increases nuclear ncRNA stability by blocking their RBM7-binding and subsequent RNA exosome targeting to allow stress-dependent modulations of the noncoding transcriptome.
18854154 Knockdown of RNA binding motif protein 7 (RBM7) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLL      1 - 70
NGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERTMDNMTSSAQIIQRSFSSPEN     71 - 140
FQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQWRQGTPSSQRKVRMNSYPYLAD    141 - 210
RHYSREQRYTDHGSDHHYRGKRDDFFYEDRNHDDWSHDYDNRRDSSRDGKWRSSRH                  211 - 266
//

Text Mined References (21)

PMID Year Title
25852104 2015 RBM7 subunit of the NEXT complex binds U-rich sequences and targets 3'-end extended forms of snRNAs.
25525152 2015 p38MAPK/MK2-mediated phosphorylation of RBM7 regulates the human nuclear exosome targeting complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...