Property Summary

NCBI Gene PubMed Count 22
PubMed Score 6.57
PubTator Score 2.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma, Non-Small-Cell Lung 107 0.0 0.0
Disease Target Count
non-small cell lung carcinoma 317
Disease Target Count P-value
ependymoma 4679 8.1e-08
ovarian cancer 8520 1.4e-04
osteosarcoma 7950 1.8e-03
group 3 medulloblastoma 4104 3.5e-03
glioblastoma 5792 9.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Pontocerebellar hypoplasia 36 4.424 2.2

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.200 8.1e-08
glioblastoma 1.200 9.1e-03
group 3 medulloblastoma 1.300 3.5e-03
osteosarcoma 1.140 1.8e-03
ovarian cancer -1.400 1.4e-04

Synonym

Accession Q9Y580 B2R6K8 Q9NUT4
Symbols

Gene

PANTHER Protein Class (1)

PDB

2M8H   5IQQ   5LXR   5LXY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLL      1 - 70
NGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERTMDNMTSSAQIIQRSFSSPEN     71 - 140
FQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQWRQGTPSSQRKVRMNSYPYLAD    141 - 210
RHYSREQRYTDHGSDHHYRGKRDDFFYEDRNHDDWSHDYDNRRDSSRDGKWRSSRH                  211 - 266
//

Text Mined References (28)

PMID Year Title