Property Summary

NCBI Gene PubMed Count 15
Grant Count 12
R01 Count 10
Funding $867,879.49
PubMed Score 73.23
PubTator Score 21.91

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (4)

PMID Text
25215946 NFATc3 interacted in a SUMO-dependent manner with Trim17, an E3 ubiquitin ligase necessary for neuronal apoptosis
22023800 the E3 ubiquitin ligase terf causes protein degradation of ZWINT and negatively regulates cell proliferation
19472918 Observational study of gene-disease association. (HuGE Navigator)
19358823 terf interacts with TRIM44;TRIM44 inhibited ubiquitination of terf, and thus stabilized the protein.

AA Sequence

MEAVELARKLQEEATCSICLDYFTDPVMTTCGHNFCRACIQLSWEKARGKKGRRKRKGSFPCPECREMSP      1 - 70
QRNLLPNRLLTKVAEMAQQHPGLQKQDLCQEHHEPLKLFCQKDQSPICVVCRESREHRLHRVLPAEEAVQ     71 - 140
GYKLKLEEDMEYLREQITRTGNLQAREEQSLAEWQGKVKERRERIVLEFEKMNLYLVEEEQRLLQALETE    141 - 210
EEETASRLRESVACLDRQGHSLELLLLQLEERSTQGPLQMLQDMKEPLSRKNNVSVQCPEVAPPTRPRTV    211 - 280
CRVPGQIEVLRGFLEDVVPDATSAYPYLLLYESRQRRYLGSSPEGSGFCSKDRFVAYPCAVGQTAFSSGR    281 - 350
HYWEVGMNITGDALWALGVCRDNVSRKDRVPKCPENGFWVVQLSKGTKYLSTFSALTPVMLMEPPSHMGI    351 - 420
FLDFEAGEVSFYSVSDGSHLHTYSQATFPGPLQPFFCLGAPKSGQMVISTVTMWVKG                 421 - 477
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25215946 2015 Control of neuronal apoptosis by reciprocal regulation of NFATc3 and Trim17.
25127057 2014 TRIM proteins regulate autophagy and can target autophagic substrates by direct recognition.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
22023800 2012 Terf/TRIM17 stimulates degradation of kinetochore protein ZWINT and regulates cell proliferation.
19472918 2008 Candidate-gene testing for orphan limb-girdle muscular dystrophies.
19358823 2009 TRIM44 interacts with and stabilizes terf, a TRIM ubiquitin E3 ligase.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...