Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.08
PubTator Score 5.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Pulmonary function (finding) 33
Disease Target Count P-value
lung carcinoma 2844 3.80259934524339E-26
osteosarcoma 7933 8.75899226679406E-9
psoriasis 6685 8.2175846228759E-6
invasive ductal carcinoma 2950 0.00106402793477332
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -3.400 0.000
osteosarcoma -3.689 0.000
lung carcinoma 1.200 0.000
invasive ductal carcinoma -1.200 0.001

Synonym

Accession Q9Y576 A6NL50 Q4ZG29 Q9ULS4 ASB-1
Symbols ASB-1

Gene

  Ortholog (13)

 GWAS Trait (1)

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAEGGSPDGRAGPGSAGRNLKEWLREQFCDHPLEHCEDTRLHDAAYVGDLQTLRSLLQEESYRSRINEKS      1 - 70
VWCCGWLPCTPLRIAATAGHGSCVDFLIRKGAEVDLVDVKGQTALYVAVVNGHLESTQILLEAGADPNGS     71 - 140
RHHRSTPVYHASRVGRADILKALIRYGADVDVNHHLTPDVQPRFSRRLTSLVVCPLYISAAYHNLQCFRL    141 - 210
LLLAGANPDFNCNGPVNTQGFYRGSPGCVMDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPESRGRRK    211 - 280
VDPEALQVFKEARSVPRTLLCLCRVAVRRALGKHRLHLIPSLPLPDPIKKFLLHE                   281 - 335
//

Text Mined References (13)

PMID Year Title
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16325183 2005 ASB proteins interact with Cullin5 and Rbx2 to form E3 ubiquitin ligase complexes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12076535 2002 The SOCS box: a tale of destruction and degradation.
11509662 2001 Functional analysis of Asb-1 using genetic modification in mice.
11111040 2000 Cloning and characterization of the genes encoding the ankyrin repeat and SOCS box-containing proteins Asb-1, Asb-2, Asb-3 and Asb-4.
More...