Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.75
PubTator Score 5.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 3.8e-26
osteosarcoma 7950 6.5e-07
psoriasis 6694 9.8e-06
invasive ductal carcinoma 2951 1.1e-03
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 2.9
Disease Target Count Z-score Confidence
Agoraphobia 21 3.638 1.8
Generalized anxiety disorder 29 3.227 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
invasive ductal carcinoma -1.200 1.1e-03
lung carcinoma 1.200 3.8e-26
osteosarcoma -2.613 6.5e-07
psoriasis -2.600 9.8e-06

Gene RIF (1)

AA Sequence

MAEGGSPDGRAGPGSAGRNLKEWLREQFCDHPLEHCEDTRLHDAAYVGDLQTLRSLLQEESYRSRINEKS      1 - 70
VWCCGWLPCTPLRIAATAGHGSCVDFLIRKGAEVDLVDVKGQTALYVAVVNGHLESTQILLEAGADPNGS     71 - 140
RHHRSTPVYHASRVGRADILKALIRYGADVDVNHHLTPDVQPRFSRRLTSLVVCPLYISAAYHNLQCFRL    141 - 210
LLLAGANPDFNCNGPVNTQGFYRGSPGCVMDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPESRGRRK    211 - 280
VDPEALQVFKEARSVPRTLLCLCRVAVRRALGKHRLHLIPSLPLPDPIKKFLLHE                   281 - 335
//

Text Mined References (13)

PMID Year Title