Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.85
PubTator Score 2.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Anorexia nervosa 80 0.0 1.0
Brain infarction 22 0.0 3.0
Multiple Sclerosis 540 0.0 0.8
Disease Target Count Z-score Confidence
Retinitis pigmentosa 11 59 3.347 1.7

Expression

Gene RIF (3)

AA Sequence

MDFTEAYADTCSTVGLAAREGNVKVLRKLLKKGRSVDVADNRGWMPIHEAAYHNSVECLQMLINADSSEN      1 - 70
YIKMKTFEGFCALHLAASQGHWKIVQILLEAGADPNATTLEETTPLFLAVENGQIDVLRLLLQHGANVNG     71 - 140
SHSMCGWNSLHQASFQENAEIIKLLLRKGANKECQDDFGITPLFVAAQYGKLESLSILISSGANVNCQAL    141 - 210
DKATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDSWQLPIHAAAQMGHTKILDLLIPLTNRACDTGLNK    211 - 280
VSPVYSAVFGGHEDCLEILLRNGYSPDAQACLVFGFSSPVCMAFQKDCEFFGIVNILLKYGAQINELHLA    281 - 350
YCLKYEKFSIFRYFLRKGCSLGPWNHIYEFVNHAIKAQAKYKEWLPHLLVAGFDPLILLCNSWIDSVSID    351 - 420
TLIFTLEFTNWKTLAPAVERMLSARASNAWILQQHIATVPSLTHLCRLEIRSSLKSERLRSDSYISQLPL    421 - 490
PRSLHNYLLYEDVLRMYEVPELAAIQDG                                              491 - 518
//

Text Mined References (14)

PMID Year Title