Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.87
PubTator Score 3.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 5.4e-47
psoriasis 6694 9.4e-15
ovarian cancer 8520 1.3e-07
medulloblastoma, large-cell 6241 2.2e-03
pituitary cancer 1972 3.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
lung carcinoma 5.000 5.4e-47
medulloblastoma, large-cell 1.100 2.2e-03
ovarian cancer 1.100 1.3e-07
pituitary cancer -2.100 3.8e-03
psoriasis -1.200 9.4e-15

Protein-protein Interaction (2)

Gene RIF (1)

AA Sequence

MDGTTAPVTKSGAAKLVKRNFLEALKSNDFGKLKAILIQRQIDVDTVFEVEDENMVLASYKQGYWLPSYK      1 - 70
LKSSWATGLHLSVLFGHVECLLVLLDHNATINCRPNGKTPLHVACEMANVDCVKILCDRGAKLNCYSLSG     71 - 140
HTALHFCTTPSSILCAKQLVWRGANVNMKTNNQDEETPLHTAAHFGLSELVAFYVEHGAIVDSVNAHMET    141 - 210
PLAIAAYWALRFKEQEYSTEHHLVCRMLLDYKAEVNARDDDFKSPLHKAAWNCDHVLMHMMLEAGAEANL    211 - 280
MDINGCAAIQYVLKVTSVRPAAQPEICYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIRW    281 - 350
NTKWRRAIPDDDLEKYWDFYHSLFTVCCNSPRTLMHLSRCAIRRTLHNRCHRAIPLLSLPLSLKKYLLLE    351 - 420
PEGIIY                                                                    421 - 426
//

Text Mined References (10)

PMID Year Title