Property Summary

NCBI Gene PubMed Count 65
Grant Count 27
R01 Count 24
Funding $2,176,924.61
PubMed Score 129.51
PubTator Score 113.73

Knowledge Summary

Patent (4,690)

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.300 0.007

 IMPC Term (1)

Gene RIF (45)

PMID Text
26900751 CHIP is a bona fide negative regulator of the RIPK1-RIPK3 necrosome formation leading to desensitization of TNF-mediated necroptosis
26437789 CNOT3 suppression promotes necroptosis by stabilizing mRNAs for cell death-inducing proteins, Ripk1 and Ripk3.
26381214 Results identify a crucial role for RIPK3-PGAM5-Drp1/NFAT signalling in NKT cell activation, and further suggest that RIPK3-PGAM5 signalling may mediate crosstalk between mitochondrial function and immune signalling.
26355347 RIPK3 expression may allow unmasking the necroptotic signalling machinery in melanoma and points to reactivation of this pathway as a treatment option for metastatic melanoma.
26269957 Additionally, later in infection, RIP3 is cleaved by the coxsackievirus B3-encoded cysteine protease 3C(pro), which serves to abrogate RIP3-mediated necrotic signaling and induce a nonnecrotic form of cell death.
25952668 The RIP3 expression is reduced in tumors compared to normal tissue in 85% of breast cancer patients, suggesting that RIP3 deficiency is positively selected during tumor growth/development.
25906154 Data implicate the infiltrating macrophages as a source of damaging inflammasomes after photoreceptor detachment in a RIP3-dependent manner and suggest a novel therapeutic target for treatment of retinal diseases.
25888634 PolyIC stimulation of cervical cancer cells induced necroptotic cell death, which was strictly dependent on the expression of the receptor-interacting protein kinase RIPK3.
25852146 RIP3 activation following the induction of necroptosis requires the activity of an HSP90 and CDC37 cochaperone complex.
25778401 Suppression of RIP3-dependent necroptosis by human cytomegalovirus
More...

AA Sequence

MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTVFRAQHRKWGYDVAVKIVNSKAISREVKAMASLDNE      1 - 70
FVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGLLQSQCPRPWPLLCRLLKEVVLGMFYLHDQNPVLLH     71 - 140
RDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGIL    141 - 210
MWAVLAGREVELPTEPSLVYEAVCNRQNRPSLAELPQAGPETPGLEGLKELMQLCWSSEPKDRPSFQECL    211 - 280
PKTDEVFQMVENNMNAAVSTVKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLN    281 - 350
KLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG    351 - 420
PRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQH    421 - 490
PPPVGSQEGPKDPEAWSRPQGWYNHSGK                                              491 - 518
//

Text Mined References (70)

PMID Year Title
26900751 2016 CHIP controls necroptosis through ubiquitylation- and lysosome-dependent degradation of RIPK3.
26559832 2015 Herpes Simplex Virus 1 (HSV-1) and HSV-2 Mediate Species-Specific Modulations of Programmed Necrosis through the Viral Ribonucleotide Reductase Large Subunit R1.
26437789 2015 CNOT3 suppression promotes necroptosis by stabilizing mRNAs for cell death-inducing proteins.
26381214 2015 Regulation of NKT cell-mediated immune responses to tumours and liver inflammation by mitochondrial PGAM5-Drp1 signalling.
26355347 2015 Absence of RIPK3 predicts necroptosis resistance in malignant melanoma.
26269957 2015 RIP3 Regulates Autophagy and Promotes Coxsackievirus B3 Infection of Intestinal Epithelial Cells.
25952668 2015 Methylation-dependent loss of RIP3 expression in cancer represses programmed necrosis in response to chemotherapeutics.
25906154 2015 Macrophage- and RIP3-dependent inflammasome activation exacerbates retinal detachment-induced photoreceptor cell death.
25888634 2015 RIPK3 expression in cervical cancer cells is required for PolyIC-induced necroptosis, IL-1? release, and efficient paracrine dendritic cell activation.
25852146 2015 A cytosolic heat shock protein 90 and cochaperone CDC37 complex is required for RIP3 activation during necroptosis.
More...