Property Summary

Ligand Count 1
NCBI Gene PubMed Count 75
PubMed Score 161.69
PubTator Score 113.73

Knowledge Summary

Patent (4,690)

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.300 6.9e-03

 IMPC Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (56)

AA Sequence

MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTVFRAQHRKWGYDVAVKIVNSKAISREVKAMASLDNE      1 - 70
FVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGLLQSQCPRPWPLLCRLLKEVVLGMFYLHDQNPVLLH     71 - 140
RDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGIL    141 - 210
MWAVLAGREVELPTEPSLVYEAVCNRQNRPSLAELPQAGPETPGLEGLKELMQLCWSSEPKDRPSFQECL    211 - 280
PKTDEVFQMVENNMNAAVSTVKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLN    281 - 350
KLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG    351 - 420
PRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQH    421 - 490
PPPVGSQEGPKDPEAWSRPQGWYNHSGK                                              491 - 518
//

Text Mined References (80)

PMID Year Title