Property Summary

Ligand Count 2
NCBI Gene PubMed Count 18
PubMed Score 33.12
PubTator Score 17.53

Knowledge Summary


No data available


  Disease (3)


  Differential Expression (7)

Disease log2 FC p
diabetes mellitus -1.100 4.9e-03
intraductal papillary-mucinous neoplasm ... 1.400 1.0e-03
lung cancer 1.300 7.0e-04
lung carcinoma 1.400 1.3e-30
malignant mesothelioma 2.000 5.6e-08
osteosarcoma -1.148 5.7e-04
ovarian cancer 1.600 2.8e-08

Gene RIF (10)

AA Sequence

VHEDAPDKVAEAVATFLIRHRFAEPIGGFQCVFPGC                                      351 - 386

Text Mined References (29)

PMID Year Title