Property Summary

NCBI Gene PubMed Count 14
PubMed Score 26.08
PubTator Score 6.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
dermatomyositis 1.300 6.3e-04
intraductal papillary-mucinous neoplasm ... 1.100 3.5e-03
oligodendroglioma -1.400 1.5e-02
ovarian cancer -1.300 2.5e-04
Polycystic ovary syndrome 1.063 7.9e-03

Gene RIF (3)

AA Sequence

MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQ      1 - 70
TLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVS     71 - 140
NLSS                                                                      141 - 144
//

Text Mined References (18)

PMID Year Title