Property Summary

NCBI Gene PubMed Count 14
Grant Count 4
R01 Count 2
Funding $267,282.75
PubMed Score 21.88
PubTator Score 6.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
oligodendroglioma -1.400 0.015
intraductal papillary-mucinous neoplasm ... 1.100 0.003
Polycystic Ovary Syndrome 1.063 0.008
ovarian cancer -1.300 0.000
dermatomyositis 1.300 0.001

Synonym

Accession Q9Y547 A6NG57 D3DQ45 Q9Y684
Symbols PP25
IFT25
C1orf41
HSPCO34

Gene

PDB

1TVG   1XPW  

Gene RIF (3)

PMID Text
26694816 HSPB11 are induced during multiple sclerosis lesion development in white but not grey matter.
18154656 Hsp16.2 expression is directly correlated with the histological grade of brain tumors.
17275951 These data suggest that Hsp16.2 can prevent the destabilization of mitochondrial membrane systems and could represent a suitable target for modulating cell death pathways.

AA Sequence

MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQ      1 - 70
TLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVS     71 - 140
NLSS                                                                      141 - 144
//

Text Mined References (18)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26694816 2015 Small heat shock proteins are induced during multiple sclerosis lesion development in white but not grey matter.
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19921466 2010 Why proteins without an alpha-crystallin domain should not be included in the human small heat shock protein family HSPB.
19253336 2009 Characterization of mouse IFT complex B.
18816799 2009 Improving NMR protein structure quality by Rosetta refinement: a molecular replacement study.
18154656 2007 Correlation between the progressive cytoplasmic expression of a novel small heat shock protein (Hsp16.2) and malignancy in brain tumors.
17275951 2007 Preventing apoptotic cell death by a novel small heat shock protein.
More...