Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.67
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung cancer 4740 4.0e-04
group 3 medulloblastoma 4104 1.2e-03
colon cancer 1478 2.1e-02

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer 1.100 2.1e-02
group 3 medulloblastoma 1.300 1.2e-03
lung cancer 1.200 4.0e-04

Gene RIF (1)

AA Sequence

MSYYLSSENHLDPGPIYMRENGQLHMVNLALDGVRSSLQKPRPFRLFPKGFSVELCMNREDDTARKEKTD      1 - 70
HFIFTYTREGNLRYSAKSLFSLVLGFISDNVDHIDSLIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQK     71 - 140
FTEAYGSLVLCSLCLRNRYLVISEKLEEIKSFRELTCLDLSCCKLGDEHELLEHLTNEALSSVTQLHLKD    141 - 210
NCLSDAGVRKMTAPVRVMKRGLENLTLLDLSCNPEITDAGIGYLFSFRKLNCLDISGTGLKDIKTVKHKL    211 - 280
QTHIGLVHSKVPLKEFDHSNCKTEGWADQIVLQWERVTAEAVKPRETSEPRAAAQRFYGKRSRAEAPLKC    281 - 350
PLADTHMNSSEKLQFYKEKAPDCHGPVLKHEAISSQESKKSKKRPFEESETEQNNSSQPSKQKYVCLAVE    351 - 420
DWDLLNSY                                                                  421 - 428
//

Text Mined References (8)

PMID Year Title