Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.7e-04

Gene RIF (1)

AA Sequence

MVNSVVFFDITVDGKPLGRISIKLFADKILKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTRH      1 - 70
NGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICAAKTEWLDGKHVAFGKVKERVNIVE     71 - 140
AMEHFGYRNSKTSKKITIADCGQF                                                  141 - 164
//

Text Mined References (7)

PMID Year Title