Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

AA Sequence

MVNSVVFFDITVDGKPLGRISIKLFADKILKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTRH      1 - 70
NGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICAAKTEWLDGKHVAFGKVKERVNIVE     71 - 140
AMEHFGYRNSKTSKKITIADCGQF                                                  141 - 164
//

Text Mined References (6)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14961574 2004 Amplification of chromosome 1 sequences in lipomatous tumors and other sarcomas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11948409 2002 Positional cloning identifies a novel cyclophilin as a candidate amplified oncogene in 1q21.