Property Summary

NCBI Gene PubMed Count 13
PubMed Score 21.00
PubTator Score 19.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 5.6e-04
group 4 medulloblastoma -1.300 3.6e-05
lung adenocarcinoma -1.600 1.7e-14
non primary Sjogren syndrome sicca 1.100 2.9e-02

Gene RIF (3)

AA Sequence

MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKV      1 - 70
HFRCVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDL     71 - 140
YMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVGSISEPGLGLLSWWTSN          141 - 204
//

Text Mined References (15)

PMID Year Title