Property Summary

NCBI Gene PubMed Count 15
PubMed Score 9.78
PubTator Score 8.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -1.562 3.7e-03
aldosterone-producing adenoma -1.384 2.1e-02
ependymoma -1.100 4.5e-04
glioblastoma -1.200 1.3e-03
group 3 medulloblastoma -1.400 3.4e-02
oligodendroglioma 1.800 1.1e-02
psoriasis -1.200 9.6e-17

Synonym

Accession Q9Y534 Q8ND37
Symbols PIPPIN
dJ347H13.2

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

AA Sequence

MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFK      1 - 70
GVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPH     71 - 140
TPHETWSGQVVGS                                                             141 - 153
//

Text Mined References (16)

PMID Year Title