Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.78
PubTator Score 8.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 9.64485007363293E-17
posterior fossa group B ependymoma 1530 1.70031112591206E-5
glioblastoma 5572 0.00128810917642679
sonic hedgehog group medulloblastoma 1482 0.00159077029358311
adrenocortical carcinoma 1427 0.00366770049384051
oligodendroglioma 2849 0.0110945027703307
aldosterone-producing adenoma 664 0.0211339586973191

Expression

  Differential Expression (7)

Disease log2 FC p
oligodendroglioma 1.800 0.011
posterior fossa group B ependymoma -1.400 0.000
glioblastoma -1.200 0.001
sonic hedgehog group medulloblastoma -1.500 0.002
adrenocortical carcinoma -1.562 0.004
aldosterone-producing adenoma -1.384 0.021
psoriasis -1.200 0.000

Synonym

Accession Q9Y534 Q8ND37
Symbols PIPPIN
dJ347H13.2

Gene

  Ortholog (13)

AA Sequence

MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFK      1 - 70
GVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPH     71 - 140
TPHETWSGQVVGS                                                             141 - 153
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12801884 2003 CRHSP-24 phosphorylation is regulated by multiple signaling pathways in pancreatic acinar cells.
12767259 RNA-binding ability of PIPPin requires the entire protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...