Property Summary

NCBI Gene PubMed Count 23
PubMed Score 12.82
PubTator Score 13.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.8e-05
osteosarcoma 7950 7.3e-05
dermatomyositis 966 3.2e-03
breast carcinoma 1638 7.9e-03
Multiple myeloma 1332 9.7e-03
glioblastoma 5792 1.6e-02
Disease Target Count Z-score Confidence
psoriasis 6694 4.653 2.3
Parkinson's disease 392 0.0 0.8
Disease Target Count Z-score Confidence
Psoriatic arthritis 86 3.004 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma 1.300 7.9e-03
dermatomyositis 1.700 3.2e-03
glioblastoma 1.200 1.6e-02
Multiple myeloma 1.344 9.7e-03
osteosarcoma -1.500 7.3e-05
ovarian cancer 1.700 1.8e-05

Gene RIF (11)

AA Sequence

MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEVYEKPVQVPCGHVFCSACLQECLKPKKPVCGVCRSA      1 - 70
LAPGVRAVELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIKDASLQPRNVPNRYT     71 - 140
FPCPYCPEKNFDQEGLVEHCKLFHSTDTKSVVCPICASMPWGDPNYRSANFREHIQRRHRFSYDTFVDYD    141 - 210
VDEEDMMNQVLQRSIIDQ                                                        211 - 228
//

Text Mined References (27)

PMID Year Title