Property Summary

NCBI Gene PubMed Count 23
Grant Count 5
R01 Count 5
Funding $129,506.22
PubMed Score 11.61
PubTator Score 13.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.344 0.010
osteosarcoma -1.500 0.000
glioblastoma 1.300 0.000
breast carcinoma 1.300 0.008
ovarian cancer 1.700 0.000
dermatomyositis 1.700 0.003

Synonym

Accession Q9Y508 B2RDQ9 B4DWY5 E1P627 Q6N0B0
Symbols ZNF313
PSORS12

Gene

PANTHER Protein Class (2)

Gene RIF (11)

PMID Text
25313037 XAF1 stimulates HIPK2-mediated Ser-46 phosphorylation of p53 and XAF1 also steps up the termination of p53-mediated cell-cycle arrest by activating ZNF313.
25165885 RNF114 is a new partner of A2O involved in the regulation of NF-kappaB activity that contributes to the control of signaling pathways modulating T cell-mediated immune response.
24631332 RNF114 over-expression had a promotion effect on T cell activation with an average 43.97% increment and the upregulatory roles showed a dose-dependent effect with 18.44% increment.
23645206 ZNF313 is a novel cell cycle activator with an E3 ligase activity inhibiting cellular senescence by destabilizing p21(WAF1.).
23617596 A single nucleotide plymorphism had an association with psoriasis in this Chinese Uygur population: SNP rs495337 in the gene encoding for zinc finger protein 313 (P < 0.001; OR = 0.80)
22205304 Rare disease-associated variants in the promoter region of the RNF114 psoriasis susceptibility gene have been identified.
21571784 RNF114 regulates a positive feedback loop that enhances double-stranded RNA induced production of type I interferon.
20953189 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20515446 ZNF313 is controlled at the transcriptional level, and a common mechanism controlling the basal transcription of ZNF313 gene exists.
18364390 ZNF313 is a novel psoriasis susceptibility gene.
More...

AA Sequence

MAAQQRDCGGAAQLAGPAAEADPLGRFTCPVCLEVYEKPVQVPCGHVFCSACLQECLKPKKPVCGVCRSA      1 - 70
LAPGVRAVELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIKDASLQPRNVPNRYT     71 - 140
FPCPYCPEKNFDQEGLVEHCKLFHSTDTKSVVCPICASMPWGDPNYRSANFREHIQRRHRFSYDTFVDYD    141 - 210
VDEEDMMNQVLQRSIIDQ                                                        211 - 228
//

Publication (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25313037 2014 XAF1 directs apoptotic switch of p53 signaling through activation of HIPK2 and ZNF313.
25165885 2014 The RING ubiquitin E3 RNF114 interacts with A20 and modulates NF-?B activity and T-cell activation.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24631332 2014 Identification of RNF114 as a novel positive regulatory protein for T cell activation.
23645206 2013 ZNF313 is a novel cell cycle activator with an E3 ligase activity inhibiting cellular senescence by destabilizing p21(WAF1.).
23617596 2013 Genetic variants of the genes encoding zinc finger protein 313 and interleukin-13 confer a risk for psoriasis in a Chinese Uygur population.
22205304 2012 Identification of rare, disease-associated variants in the promoter region of the RNF114 psoriasis susceptibility gene.
21571784 2011 Functional analysis of the RNF114 psoriasis susceptibility gene implicates innate immune responses to double-stranded RNA in disease pathogenesis.
21269460 2011 Initial characterization of the human central proteome.
More...