Property Summary

NCBI Gene PubMed Count 39
Grant Count 146
R01 Count 86
Funding $16,692,505.35
PubMed Score 235.50
PubTator Score 104.71

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y4Z2 Q5VVI0 Q6DJX6 Q9BY24 NGN-3
Symbols ngn3
Atoh5
NGN-3
Math4B
bHLHa7

Gene

PANTHER Protein Class (2)

 GO Component (2)

Gene RIF (34)

PMID Text
26345820 ChIP experiments confirmed that Pdx1 activates the expression of the downstream transcription factors, Ngn3 and Pax6, by combined with the promoter regions of insulin (Insulin-P), Ngn3 (Ngn3-P), and Pax6 (Pax6-P).
26288179 NGN3 expression in the adult human exocrine pancreas marks a dedifferentiating cell population.
25650326 conclude that NEUROG3 is essential for endocrine pancreas development in humans and that as little as 10% NEUROG3 is sufficient for formation of pancreatic endocrine cells
25120094 NEUROG3 deficiency produces a rare clinical syndrome characterised by severe malabsorptive diarrhoea from early life and mild diabetes with a variable age of onset.
24969979 The expression of transcription factor Ngn3 and pancreatic mesenchymal microenvironment are important and necessary to promote pancreatic progenitors differentiated to islet cells regardless of pancreatic development or islets regeneration.
24925797 Activation of the developmental pathway neurogenin-3/microRNA-7a regulates cholangiocyte proliferation in response to injury.
24493854 Prospectively isolated NGN3-expressing progenitors from human embryonic stem cells give rise to pancreatic endocrine cells.
24134759 Recessively inherited NEUROG-3 mutations were originally identified in three patients with unexplained congenital malabsorptive diarrhea and an absence of EC.
23349771 Data indicate associations of SNPs in eight loci CXCR4, HHEX, FOXA2, NGN3, TCF7L2, FLJ39370 (C4orf32), LOC646279 (RPL21P7) and THADA with body mass index (BMI) and weight.
22606327 Ngn3-mediated pancreatic duct-to-endocrine cell reprogramming was measured employing genome wide mRNA profiling.
More...

AA Sequence

MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRARRGGRSR      1 - 70
PKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLTKIETLRFAHNYIWALTQTLR     71 - 140
IADHSLYALEPPAPHCGELGSPGGSPGDWGSLYSPVSQAGSLSPAASLEERPGLLGATFSACLSPGSLAF    141 - 210
SDFL                                                                      211 - 214
//

Publication (42)

PMID Year Title
26345820 2015 Pdxl and its role in activating Ngn3 and Pax6 to induce differentiation of iPSCs into islet ? cells.
26288179 2015 Neurogenin 3 Expressing Cells in the Human Exocrine Pancreas Have the Capacity for Endocrine Cell Fate.
25650326 2015 The Basic Helix-Loop-Helix Transcription Factor NEUROG3 Is Required for Development of the Human Endocrine Pancreas.
25416956 2014 A proteome-scale map of the human interactome network.
25120094 2014 Neurogenin 3 is important but not essential for pancreatic islet development in humans.
24969979 2014 Short-reactivation of neurogenin-3 and mesenchymal microenvironment is require for ?-cells differentiation during fetal pancreas development and islet regeneration.
24925797 2014 Activation of the developmental pathway neurogenin-3/microRNA-7a regulates cholangiocyte proliferation in response to injury.
24493854 2014 Prospectively isolated NGN3-expressing progenitors from human embryonic stem cells give rise to pancreatic endocrine cells.
24134759 2013 Extremely rare cause of congenital diarrhea: enteric anendocrinosis.
23349771 2013 Association study of 25 type 2 diabetes related Loci with measures of obesity in Indian sib pairs.
More...