Property Summary

NCBI Gene PubMed Count 46
PubMed Score 252.94
PubTator Score 104.71

Knowledge Summary

Patent

No data available

Expression

 GO Component (2)

Gene RIF (40)

AA Sequence

MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRARRGGRSR      1 - 70
PKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLTKIETLRFAHNYIWALTQTLR     71 - 140
IADHSLYALEPPAPHCGELGSPGGSPGDWGSLYSPVSQAGSLSPAASLEERPGLLGATFSACLSPGSLAF    141 - 210
SDFL                                                                      211 - 214
//

Text Mined References (49)

PMID Year Title