Property Summary

NCBI Gene PubMed Count 25
PubMed Score 139.89
PubTator Score 12.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 2.21325908320486E-12
tuberculosis 1563 3.29928959941001E-8
osteosarcoma 7933 7.9408258647281E-7
ovarian cancer 8492 1.55590814484061E-5
lung cancer 4473 1.61704212225569E-5
lung adenocarcinoma 2714 6.78333019221539E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.91660095358135E-4
invasive ductal carcinoma 2950 7.8348009850713E-4
Rheumatoid Arthritis 1171 0.00468427268712629
astrocytic glioma 2241 0.0100315971334492
primary pancreatic ductal adenocarcinoma 1271 0.0115593324133042
dermatomyositis 967 0.0184971757316099
pancreatic cancer 2300 0.0302095295971618
group 3 medulloblastoma 2254 0.0408528408293212
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
Disease Target Count Z-score Confidence
Myxoid liposarcoma 7 3.187 1.6

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis -1.300 0.005
astrocytic glioma -1.400 0.010
osteosarcoma -1.708 0.000
tuberculosis 1.100 0.000
primary pancreatic ductal adenocarcinoma 1.316 0.012
intraductal papillary-mucinous carcinoma... 1.200 0.000
lung cancer 1.900 0.000
group 3 medulloblastoma 1.300 0.041
lung adenocarcinoma 1.164 0.000
breast carcinoma 1.100 0.000
invasive ductal carcinoma 1.200 0.001
ovarian cancer 2.800 0.000
pancreatic cancer 1.100 0.030
dermatomyositis -1.200 0.018

Synonym

Accession Q9Y4Z0
Symbols GRP
YER112W

Gene

PDB

3JCR  

  Ortholog (13)

 MGI Term (1)

Gene RIF (6)

PMID Text
24255165 C-terminal extension of Lsm4 interacts directly with the histone mRNP, contacting both SLBP and 3'hExo.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19088440 LSm4 not only acts in RNA processing, but also as a co-factor in cell volume regulation.
17178857 Gene induces transformed phenotype when overexpressed in a cancer breast cell line.
15905169 Data show that ICln159, a truncated ICln mutant, belongs to the pleckstrin homology (PH) domain family of proteins and interacts with LSm4, a protein involved in splicing and mRNA degradation.
12515382 LSm1-7 proteins colocalize with DCP1,DCP2 and Xrn1 in cytoplasmic foci

AA Sequence

MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLR      1 - 70
IPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ      71 - 139
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255165 2014 The C-terminal extension of Lsm4 interacts directly with the 3' end of the histone mRNP and is required for efficient histone mRNA degradation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
More...