Property Summary

NCBI Gene PubMed Count 27
PubMed Score 131.99
PubTator Score 12.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.200 2.9e-02
breast carcinoma 1.100 2.2e-12
dermatomyositis -1.200 1.8e-02
group 3 medulloblastoma 1.300 4.1e-02
intraductal papillary-mucinous carcinoma... 1.200 4.9e-04
invasive ductal carcinoma 1.200 7.8e-04
lung adenocarcinoma 1.164 6.8e-05
lung cancer 1.300 1.3e-02
osteosarcoma 1.536 1.7e-05
ovarian cancer 2.800 1.6e-05
pancreatic cancer 1.100 3.0e-02
primary pancreatic ductal adenocarcinoma 1.316 1.2e-02
Rheumatoid arthritis -1.300 4.7e-03
tuberculosis 1.100 3.3e-08

 MGI Phenotype (1)

Gene RIF (7)

AA Sequence

MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLR      1 - 70
IPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ      71 - 139
//

Text Mined References (31)

PMID Year Title