Property Summary

NCBI Gene PubMed Count 18
Grant Count 14
Funding $2,734,239.25
PubMed Score 8.80
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

 GO Function (1)

Gene RIF (1)

PMID Text
12515382 LSm1-7 proteins colocalize with DCP1,DCP2 and Xrn1 in cytoplasmic foci

AA Sequence

MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLD      1 - 70
QILLNGNNITMLVPGGEGPEV                                                      71 - 91
//

Publication (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...