Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.80
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Polycystic Ovary Syndrome 335
Disease Target Count P-value
astrocytoma 1493 4.86695268159748E-17
oligodendroglioma 2849 4.62272360351544E-14
posterior fossa group A ependymoma 1511 1.94141582481166E-9
glioblastoma 5572 2.21606261913845E-9
primitive neuroectodermal tumor 3031 2.56865210321848E-6
pilocytic astrocytoma 3086 1.21944711580547E-5
malignant mesothelioma 3163 4.70192046796099E-5
medulloblastoma, large-cell 6234 5.52753583645815E-5
group 3 medulloblastoma 2254 7.52937975704371E-5
atypical teratoid/rhabdoid tumor 1095 1.42733004407203E-4
adult high grade glioma 2148 1.72182035672213E-4
nasopharyngeal carcinoma 1056 4.31193074770063E-4
psoriasis 6685 5.0187472016832E-4
lung cancer 4473 0.00128439712665282
Multiple myeloma 1328 0.00163102059918085
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00298466659192449
ovarian cancer 8492 0.00904707406462752
Pneumonia 133 0.00982247392436824
aldosterone-producing adenoma 664 0.0117291119795696

Expression

  Differential Expression (19)

Synonym

Accession Q9Y4Y9
Symbols YER146W

Gene

PDB

3JCR  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (1)

PMID Text
12515382 LSm1-7 proteins colocalize with DCP1,DCP2 and Xrn1 in cytoplasmic foci

AA Sequence

MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLD      1 - 70
QILLNGNNITMLVPGGEGPEV                                                      71 - 91
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
More...