Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.80
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 2.000 1.7e-04
aldosterone-producing adenoma -1.149 1.2e-02
astrocytoma 1.500 4.9e-17
Astrocytoma, Pilocytic 1.400 2.4e-05
atypical teratoid / rhabdoid tumor 1.300 1.5e-03
ependymoma 1.600 1.4e-09
glioblastoma 2.000 2.2e-09
group 3 medulloblastoma 2.200 7.5e-05
intraductal papillary-mucinous neoplasm ... 1.600 3.0e-03
lung cancer 1.100 1.5e-02
malignant mesothelioma 1.200 4.7e-05
medulloblastoma, large-cell 1.200 6.6e-03
Multiple myeloma 1.659 1.6e-03
nasopharyngeal carcinoma 1.300 4.3e-04
oligodendroglioma 1.500 4.6e-14
ovarian cancer 1.200 1.1e-02
Pneumonia -1.300 9.8e-03
primitive neuroectodermal tumor 1.900 2.6e-06
psoriasis -1.200 5.0e-04

 GO Function (1)

Gene RIF (1)

AA Sequence

MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLD      1 - 70
QILLNGNNITMLVPGGEGPEV                                                      71 - 91
//

Text Mined References (22)

PMID Year Title