Property Summary

NCBI Gene PubMed Count 18
PubMed Score 162.64
PubTator Score 52.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.126 0.015
psoriasis -1.400 0.000
osteosarcoma 2.594 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.200 0.000
adult high grade glioma -1.300 0.000
pilocytic astrocytoma -1.100 0.000
subependymal giant cell astrocytoma -1.087 0.043
spina bifida -1.400 0.033
Pick disease 1.200 0.000
ovarian cancer -1.500 0.000

Synonym

Accession Q9Y4X5 B2R6U3 O76026 Q9H3T6 Q9UEN0 Q9UP39
Symbols ARI
HARI
HHARI
UBCH7BP

Gene

PANTHER Protein Class (2)

PDB

1WD2   2M9Y   4KBL   4KC9  

Gene RIF (7)

PMID Text
25624349 DNA damage induces an increase in ARIH1 protein levels and association of ARIH1 with 4EHP. In turn, this causes 4EHP recruitment to the mRNA cap, where it is known to compete with eIF4E.
24076655 TRIAD1 and HHARI bind to and are activated by distinct neddylated Cullin-RING ligase complexes.
24058416 Determined is the three-dimensional solution structure of the catalytic RING2 domain from HHARI. It shows glimpses of a HECT E3 ligase.
23059369 HHARI is a marker of cellular proliferation associated with nuclear bodies.
21590270 Both parkin and HHARI bind the same substrate proteins in cells and induce the formation of aggresomes.
21532592 UBCH7 exhibits activity with the RING-in-between-RING (RBR) family of E3s that includes parkin (also known as PARK2) and human homologue of ariadne (HHARI; also known as ARIH1)
15236971 the structure of the RING2 from the RING-IBR-RING motif of HHARI and showed that RING2 has a completely distinct topology from classical RINGs

AA Sequence

MDSDEGYNYEFDEDEECSEEDSGAEEEEDEDDDEPDDDTLDLGEVELVEPGLGVGGERDGLLCGETGGGG      1 - 70
GSALGPGGGGGGGGGGGGGGPGHEQEEDYRYEVLTAEQILQHMVECIREVNEVIQNPATITRILLSHFNW     71 - 140
DKEKLMERYFDGNLEKLFAECHVINPSKKSRTRQMNTRSSAQDMPCQICYLNYPNSYFTGLECGHKFCMQ    141 - 210
CWSEYLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPD    211 - 280
CHHVVKVQYPDAKPVRCKCGRQFCFNCGENWHDPVKCKWLKKWIKKCDDDSETSNWIAANTKECPKCHVT    281 - 350
IEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNR    351 - 420
YMNHMQSLRFEHKLYAQVKQKMEEMQQHNMSWIEVQFLKKAVDVLCQCRATLMYTYVFAFYLKKNNQSII    421 - 490
FENNQADLENATEVLSGYLERDISQDSLQDIKQKVQDKYRYCESRRRVLLQHVHEGYEKDLWEYIED       491 - 557
//

Publication (23)

PMID Year Title
27565346 2016 Two Distinct Types of E3 Ligases Work in Unison to Regulate Substrate Ubiquitylation.
25624349 2015 The E3 ubiquitin ligase ARIH1 protects against genotoxic stress by initiating a 4EHP-mediated mRNA translation arrest.
24076655 2013 TRIAD1 and HHARI bind to and are activated by distinct neddylated Cullin-RING ligase complexes.
24058416 2013 Structure of the HHARI catalytic domain shows glimpses of a HECT E3 ligase.
23707686 2013 Structure of HHARI, a RING-IBR-RING ubiquitin ligase: autoinhibition of an Ariadne-family E3 and insights into ligation mechanism.
23059369 2013 Human Homolog of Drosophila Ariadne (HHARI) is a marker of cellular proliferation associated with nuclear bodies.
21590270 2012 The parkin-like human homolog of Drosophila ariadne-1 (HHARI) can induce aggresome formation in mammalian cells and is immunologically detectable in Lewy bodies.
21532592 2011 UBCH7 reactivity profile reveals parkin and HHARI to be RING/HECT hybrids.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...