Property Summary

NCBI Gene PubMed Count 19
PubMed Score 179.19
PubTator Score 52.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.300 8.4e-06
Astrocytoma, Pilocytic -1.100 8.5e-07
atypical teratoid / rhabdoid tumor -1.200 1.9e-05
glioblastoma -1.200 2.7e-05
Multiple myeloma 1.126 1.5e-02
osteosarcoma 2.545 5.9e-07
ovarian cancer -1.500 9.0e-05
Pick disease 1.200 7.6e-05
psoriasis -1.400 2.4e-04
spina bifida -1.400 3.3e-02
subependymal giant cell astrocytoma -1.075 5.0e-02

Gene RIF (8)

AA Sequence

MDSDEGYNYEFDEDEECSEEDSGAEEEEDEDDDEPDDDTLDLGEVELVEPGLGVGGERDGLLCGETGGGG      1 - 70
GSALGPGGGGGGGGGGGGGGPGHEQEEDYRYEVLTAEQILQHMVECIREVNEVIQNPATITRILLSHFNW     71 - 140
DKEKLMERYFDGNLEKLFAECHVINPSKKSRTRQMNTRSSAQDMPCQICYLNYPNSYFTGLECGHKFCMQ    141 - 210
CWSEYLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVKLKYQHLITNSFVECNRLLKWCPAPD    211 - 280
CHHVVKVQYPDAKPVRCKCGRQFCFNCGENWHDPVKCKWLKKWIKKCDDDSETSNWIAANTKECPKCHVT    281 - 350
IEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRYNEDDAKAARDAQERSRAALQRYLFYCNR    351 - 420
YMNHMQSLRFEHKLYAQVKQKMEEMQQHNMSWIEVQFLKKAVDVLCQCRATLMYTYVFAFYLKKNNQSII    421 - 490
FENNQADLENATEVLSGYLERDISQDSLQDIKQKVQDKYRYCESRRRVLLQHVHEGYEKDLWEYIED       491 - 557
//

Text Mined References (24)

PMID Year Title