Property Summary

NCBI Gene PubMed Count 42
Grant Count 69
R01 Count 26
Funding $6,184,289.02
PubMed Score 461.80
PubTator Score 69.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.300 0.000

Synonym

Accession Q9Y4X3
Symbols ALP
ILC
CTAK
CTACK
PESKY
ESKINE
SCYA27

Gene

PDB

2KUM  

Gene RIF (34)

PMID Text
26295034 Our data supports previous reports showing IL-17 and -23 upregulation in association with Multiple sclerosis and potentially identify a previously unknown involvement for CCL27.
25539641 NOS2 and CCL27: clinical implications for psoriasis and eczema diagnosis and management.
24970722 Findings support the notion that CCR10 and its ligand CCL27 may contribute to the skin infiltration of malignant T-cells in mycosis fungoides and adult T-cell leukemia/lymphoma.
24710735 Our study suggests that CTACK/CCL27 may have a pivotal role in the early stage of psoriasis plaque formation, but should be downregulated in the later stage to induce inflammation characteristic for chronic psoriasis plaques
24037339 We show that the adult but not prenatal human keratinocytes produce and release large amounts of CCL27.
23980822 Seventeen mediators were identified in burn wound exudates (concentration range 0.0006-9 ng/mg total protein), including the skin-specific chemokine CCL27.
23670528 CCL27 chemokine implicates cholesteatoma keratinocytes as contributors in cholesteatoma progression.
22526457 low CCL27/CCR10 and CXCL12/CXCR4 intratumoral mRNA ratios are associated with melanoma progression
22017510 Serum concentrations of TARC and CTACK were significantly higher in AD (atopic dermatitis) children than in healthy controls, and correlated with severity of symptoms.
21993219 IL-1beta-induced CCL27 gene expression in normal human keratinocytes is regulated through the p38 MAPK/MSK1/Mnk1+2 as well as the IKKbeta/NF-kappaB signalling pathways.
More...

AA Sequence

MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLH      1 - 70
LAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG                                 71 - 112
//

Text Mined References (43)

PMID Year Title
26295034 2015 CCL27: Novel Cytokine with Potential Role in Pathogenesis of Multiple Sclerosis.
25539641 2015 NOS2 and CCL27: clinical implications for psoriasis and eczema diagnosis and management.
24970722 2014 Microarray analysis of gene expression by microdissected epidermis and dermis in mycosis fungoides and adult T-cell leukemia/lymphoma.
24710735 2014 CCL27 is downregulated by interferon gamma via epidermal growth factor receptor in normal human epidermal keratinocytes.
24037339 2014 Epidermal CCL27 expression is regulated during skin development and keratinocyte differentiation.
23980822 2014 Differential response of human adipose tissue-derived mesenchymal stem cells, dermal fibroblasts, and keratinocytes to burn wound exudates: potential role of skin-specific chemokine CCL27.
23670528 2013 Differential gene expression in cholesteatoma by DNA chip analysis.
22526457 2012 CCL27-CCR10 and CXCL12-CXCR4 chemokine ligand-receptor mRNA expression ratio: new predictive factors of tumor progression in cutaneous malignant melanoma.
22017510 2012 Serum TARC and CTACK concentrations in children with atopic dermatitis, allergic asthma, and urticaria.
21993219 2011 CCL27 expression is regulated by both p38 MAPK and IKK? signalling pathways.
More...