Property Summary

NCBI Gene PubMed Count 46
PubMed Score 519.65
PubTator Score 69.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.300 5.6e-15

Synonym

Accession Q9Y4X3
Symbols ALP
ILC
CTAK
CTACK
PESKY
ESKINE
SCYA27

Gene

PDB

2KUM  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Protein-protein Interaction (1)

Gene RIF (37)

AA Sequence

MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLH      1 - 70
LAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG                                 71 - 112
//

Text Mined References (47)

PMID Year Title