Property Summary

NCBI Gene PubMed Count 6
PubMed Score 9.94
PubTator Score 3.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,683

Synonym

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
19858781 Results show that UGT2A2 not only shares exons 2-6 with UGT2A1, it also shares with it a similar tissue expression pattern; both UGTs are primarily expressed in nasal epithelium. The 3rd member of UGT2A subfamily, UGT2A3 exhibited a different tissue expression pattern, found mainly in liver and small intestine.

AA Sequence

MLNNLLLFSLQISLIGTTLGGNVLIWPMEGSHWLNVKIIIDELIKKEHNVTVLVASGALFITPTSNPSLT      1 - 70
FEIYRVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHMVSQEICDGVLKNQQLMAKLK     71 - 140
KSKFEVLVSDPVFPCGDIVALKLGIPFMYSLRFSPASTVEKHCGKVPYPPSYVPAVLSELTDQMSFTDRI    141 - 210
RNFISYHLQDYMFETLWKSWDSYYSKALGRPTTLCETMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHC    211 - 280
KPAKPLPKEMEEFIQSSGKNGVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYKGKKPATLGNNTQ    281 - 350
LFDWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNLNTMTS    351 - 420
VDLLSALRTVINEPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLD    421 - 490
VIGFLLVCVTTAIFLVIQCCLFSCQKFGKIGKKKKRE                                     491 - 527
//

Publication (7)

PMID Year Title
23086198 2013 Importance of UDP-glucuronosyltransferases 2A2 and 2A3 in tobacco carcinogen metabolism.
19858781 2009 Human UDP-glucuronosyltransferase UGT2A2: cDNA construction, expression, and functional characterization in comparison with UGT2A1 and UGT2A3.
16141793 2005 Nomenclature update for the mammalian UDP glycosyltransferase (UGT) gene superfamily.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
10359671 1999 Cloning and characterization of a novel human olfactory UDP-glucuronosyltransferase.
9847074 1998 Toward a complete human genome sequence.