Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.78
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
19460752 Knockdown of Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1 (AMMECR1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
15558565 PH0010 from Pyrococcus horikoshii is highly homologous to human AMMECR 1C-terminal region

AA Sequence

MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTL      1 - 70
SPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYC     71 - 140
HLYGYQQPRTPRFTNEPYPLFVTWKIGRDKRLRGCIGTFSAMNLHSGLREYTLTSALKDSRFPPMTRDEL    141 - 210
PRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGY    211 - 280
KAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS                     281 - 333
//

Text Mined References (14)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
24646681 2014 A highly conserved family of domains related to the DNA-glycosylase fold helps predict multiple novel pathways for RNA modifications.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21304492 2011 Amer1/WTX couples Wnt-induced formation of PtdIns(4,5)P2 to LRP6 phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15558565 2005 Crystal structure of PH0010 from Pyrococcus horikoshii, which is highly homologous to human AMMECR 1C-terminal region.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...