Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.76
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Pyloric Stenosis 47 3.429 1.7
Disease Target Count
Amme Complex 3

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.090 1.2e-02
Breast cancer 3.200 2.3e-02
cystic fibrosis -1.100 2.2e-04
ductal carcinoma in situ 1.500 3.0e-04
gastric carcinoma 1.200 4.7e-02
glioblastoma 1.100 1.6e-04
intraductal papillary-mucinous adenoma (... 1.700 6.9e-03
intraductal papillary-mucinous carcinoma... 2.000 5.9e-03
intraductal papillary-mucinous neoplasm ... 2.000 2.2e-02
invasive ductal carcinoma 1.200 5.0e-02
lung cancer -1.500 3.1e-04
medulloblastoma, large-cell 1.500 1.0e-05
non-small cell lung cancer 1.138 1.5e-10
osteosarcoma 1.547 2.8e-04
ovarian cancer -2.400 8.4e-07
pediatric high grade glioma 1.300 6.1e-06
posterior fossa group A ependymoma 1.200 3.5e-06
psoriasis 1.700 3.3e-10
spina bifida -2.151 3.0e-02
tuberculosis and treatment for 6 months 1.100 6.3e-06

Gene RIF (4)

AA Sequence

MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTL      1 - 70
SPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYC     71 - 140
HLYGYQQPRTPRFTNEPYPLFVTWKIGRDKRLRGCIGTFSAMNLHSGLREYTLTSALKDSRFPPMTRDEL    141 - 210
PRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGY    211 - 280
KAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS                     281 - 333
//

Text Mined References (16)

PMID Year Title