Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.91
PubTator Score 3.71

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.300 1.1e-04
atypical teratoid / rhabdoid tumor -1.300 3.7e-08
ependymoma -1.200 5.8e-10
glioblastoma -1.100 4.4e-07
group 3 medulloblastoma 1.300 2.7e-04
malignant mesothelioma 1.200 3.6e-06
medulloblastoma, large-cell 1.100 4.9e-04

 GO Function (1)

Gene RIF (3)

AA Sequence

MSWESGAGPGLGSQGMDLVWSAWYGKCVKGKGSLPLSAHGIVVAWLSRAEWDQVTVYLFCDDHKLQRYAL      1 - 70
NRITVWRSRSGNELPLAVASTADLIRCKLLDVTGGLGTDELRLLYGMALVRFVNLISERKTKFAKVPLKC     71 - 140
LAQEVNIPDWIVDLRHELTHKKMPHINDCRRGCYFVLDWLQKTYWCRQLENSLRETWELEEFREGIEEED    141 - 210
QEEDKNIVVDDITEQKPEPQDDGKSTESDVKADGDSKGSEEVDSHCKKALSHKELYERARELLVSYEEEQ    211 - 280
FTVLEKFRYLPKAIKAWNNPSPRVECVLAELKGVTCENREAVLDAFLDDGFLVPTFEQLAALQIEYEDGQ    281 - 350
TEVQRGEGTDPKSHKNVDLNDVLVPKPFSQFWQPLLRGLHSQNFTQALLERMLSELPALGISGIRPTYIL    351 - 420
RWTVELIVANTKTGRNARRFSAGQWEARRGWRLFNCSASLDWPRMVESCLGSPCWASPQLLRIIFKAMGQ    421 - 490
GLPDEEQEKLLRICSIYTQSGENSLVQEGSEASPIGKSPYTLDSLYWSVKPASSSFGSEAKAQQQEEQGS    491 - 560
VNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEEDEDDEDDEEEDRMEVGPFSTGQESPTAENARLLAQKR    561 - 630
GALQGSAWQVSSEDVRWDTFPLGRMPGQTEDPAELMLENYDTMYLLDQPVLEQRLEPSTCKTDTLGLSCG    631 - 700
VGSGNCSNSSSSNFEGLLWSQGQLHGLKTGLQLF                                        701 - 734
//

Text Mined References (31)

PMID Year Title