Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.84
PubTator Score 3.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession Q9Y4W2 A9X410 Q5JXQ0 Q8TEN5 Q9H9V5
Symbols WTS
Las1-like
dJ475B7.2

Gene

 GO Function (1)

Gene RIF (3)

PMID Text
22190735 LAS1L interacts with PELP1, TEX10, and WDR18, the mammalian homologues of the budding yeast Rix1 complex, along with NOL9 and SENP3, to form a novel nucleolar complex that cofractionates with the 60S preribosomal subunit.
22083961 Analysis of high-molecular-weight RNAs confirmed that Las1L is required for ITS2 processing,which separates the 5.8S and 25S/28S rRNAs, as 32S was found to accumulate and 12S to diminish upon Las1L depletion.
20647540 Data demonstrate that Las1L is essential for cell proliferation and biogenesis of the 60S ribosomal subunit.

AA Sequence

MSWESGAGPGLGSQGMDLVWSAWYGKCVKGKGSLPLSAHGIVVAWLSRAEWDQVTVYLFCDDHKLQRYAL      1 - 70
NRITVWRSRSGNELPLAVASTADLIRCKLLDVTGGLGTDELRLLYGMALVRFVNLISERKTKFAKVPLKC     71 - 140
LAQEVNIPDWIVDLRHELTHKKMPHINDCRRGCYFVLDWLQKTYWCRQLENSLRETWELEEFREGIEEED    141 - 210
QEEDKNIVVDDITEQKPEPQDDGKSTESDVKADGDSKGSEEVDSHCKKALSHKELYERARELLVSYEEEQ    211 - 280
FTVLEKFRYLPKAIKAWNNPSPRVECVLAELKGVTCENREAVLDAFLDDGFLVPTFEQLAALQIEYEDGQ    281 - 350
TEVQRGEGTDPKSHKNVDLNDVLVPKPFSQFWQPLLRGLHSQNFTQALLERMLSELPALGISGIRPTYIL    351 - 420
RWTVELIVANTKTGRNARRFSAGQWEARRGWRLFNCSASLDWPRMVESCLGSPCWASPQLLRIIFKAMGQ    421 - 490
GLPDEEQEKLLRICSIYTQSGENSLVQEGSEASPIGKSPYTLDSLYWSVKPASSSFGSEAKAQQQEEQGS    491 - 560
VNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEEDEDDEDDEEEDRMEVGPFSTGQESPTAENARLLAQKR    561 - 630
GALQGSAWQVSSEDVRWDTFPLGRMPGQTEDPAELMLENYDTMYLLDQPVLEQRLEPSTCKTDTLGLSCG    631 - 700
VGSGNCSNSSSSNFEGLLWSQGQLHGLKTGLQLF                                        701 - 734
//

Publication (29)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22872859 2012 Five friends of methylated chromatin target of protein-arginine-methyltransferase[prmt]-1 (chtop), a complex linking arginine methylation to desumoylation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22190735 2012 LAS1L interacts with the mammalian Rix1 complex to regulate ribosome biogenesis.
22083961 2012 The evolutionarily conserved protein Las1 is required for pre-rRNA processing at both ends of ITS2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20647540 2010 Las1L is a nucleolar protein required for cell proliferation and ribosome biogenesis.
More...