Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.39
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.700 5.5e-03
Astrocytoma, Pilocytic -1.700 2.2e-05
atypical teratoid / rhabdoid tumor -1.500 5.6e-04
glioblastoma -1.300 1.4e-04
group 4 medulloblastoma -2.100 4.9e-04
medulloblastoma, large-cell -2.300 9.4e-05
nasopharyngeal carcinoma -1.100 3.8e-09
posterior fossa group B ependymoma 1.500 5.3e-05
primitive neuroectodermal tumor -1.700 7.0e-03

Gene RIF (1)

AA Sequence

MASSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPANSLQQKLSNWG      1 - 70
HLNRKVLKRLNFSVPDDVMRKIAQCAPGVVELVLIPLRQRLEERQRRRKQGAGSLQELAPQDGSGYMDVG     71 - 140
VSQKARGEGVPDPQGGGQLSWDRPPAPRPPAYNRALQGDPSFVLQIAEKEQELLASQETVQVLQMKVRRL    141 - 210
EHLLQLKNVRIEDLSRRLQQAERKQR                                                211 - 236
//

Text Mined References (10)

PMID Year Title