Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.89
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (1)

PMID Text
16206169 a.k.a. Spef1 (sperm flagella) and CLAMP (CaLponin-homology And Microtubule associated Protein) CLAMP/Spef1 expression also in brain, lung, and inner ear MT association of CLAMP requires the CH domain, which has highest similarity with EB family proteins

AA Sequence

MASSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPANSLQQKLSNWG      1 - 70
HLNRKVLKRLNFSVPDDVMRKIAQCAPGVVELVLIPLRQRLEERQRRRKQGAGSLQELAPQDGSGYMDVG     71 - 140
VSQKARGEGVPDPQGGGQLSWDRPPAPRPPAYNRALQGDPSFVLQIAEKEQELLASQETVQVLQMKVRRL    141 - 210
EHLLQLKNVRIEDLSRRLQQAERKQR                                                211 - 236
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25070955 2014 Radial intercalation is regulated by the Par complex and the microtubule-stabilizing protein CLAMP/Spef1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16206169 2005 CLAMP, a novel microtubule-associated protein with EB-type calponin homology.
15979255 2005 Spef1, a conserved novel testis protein found in mouse sperm flagella.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.