Property Summary

NCBI Gene PubMed Count 26
PubMed Score 13.02
PubTator Score 9.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 8.1e-10
osteosarcoma 7950 8.2e-07
psoriasis 6694 1.3e-04
medulloblastoma, large-cell 6241 3.0e-04

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.100 3.0e-04
osteosarcoma -2.113 8.2e-07
ovarian cancer 1.100 8.1e-10
psoriasis -1.300 1.3e-04

Synonym

Accession Q9Y4P8 B3KNC2 Q5MNZ8 Q6FI96 Q75L50 Q96IE4 Q9Y364 WIPI-2
Symbols Atg21
ATG18B
CGI-50
WIPI-2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

AA Sequence

MNLASQSGEAGAGQLLFANFNQDNTEVKGASRAAGLGRRAVVWSLAVGSKSGYKFFSLSSVDKLEQIYEC      1 - 70
TDTEDVCIVERLFSSSLVAIVSLKAPRKLKVCHFKKGTEICNYSYSNTILAVKLNRQRLIVCLEESLYIH     71 - 140
NIRDMKVLHTIRETPPNPAGLCALSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAALAF    141 - 210
DASGTKLATASEKGTVIRVFSIPEGQKLFEFRRGVKRCVSICSLAFSMDGMFLSASSNTETVHIFKLETV    211 - 280
KEKPPEEPTTWTGYFGKVLMASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLATIQKIPRLLVGAA    281 - 350
DGYLYMYNLDPQEGGECALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYT    351 - 420
DDLGAVGGACLEDEASALRLDEDSEHPPMILRTD                                        421 - 454
//

Text Mined References (30)

PMID Year Title