Property Summary

NCBI Gene PubMed Count 25
PubMed Score 11.57
PubTator Score 9.34

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.300 0.000
osteosarcoma -2.113 0.000
medulloblastoma, large-cell 1.200 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q9Y4P8 B3KNC2 Q5MNZ8 Q6FI96 Q75L50 Q96IE4 Q9Y364 WIPI-2
Symbols Atg21
ATG18B
CGI-50
WIPI-2

Gene

Gene RIF (8)

PMID Text
25462558 The specific autophagosomal localization of both WIPI1 and WIPI2 (refered to as WIPI puncta) has been employed to assess autophagy using fluorescence microscopy methods, such as confocal and live-cell video microscopy
25233424 Data suggest WIPI1/WIPI2 co-localize with microtubule-associated light chain 3 and autophagy related proteins 2/14L, participate in biogenesis of phagosomes, autophagy, and mobilization of lipids to/from intracellular droplets. [review-like article]
25233411 Data suggest that WIPI2b directly interacts with dimer of ATG16L1 (autophagy related 16-like 1) and this interaction is linked to production of phosphatidylinositol 3-phosphate in endoplasmic reticulum triggered by autophagosome formation. [REVIEW]
24991767 WIPI-1 and WIPI-2 are functionally required in mediating the PI3P signal at the onset of autophagy in NB4 cells.
24954904 WIPI2b binds the membrane surrounding Salmonella and recruits the Atg12-5-16L1 complex, initiating LC3 conjugation, autophagosomal membrane formation, and engulfment of Salmonella.
21564513 Freeze-fracture replica immunolabelling reveals WD-repeat protein interacting with phosphoinositides 1 and 2 (WIPI-1 and WIPI-2) as membrane components of autophagosomes and the plasma membrane (PM).
20505359 A role for WIPI2 in the progression of omegasomes into autophagosomes, is reported.
20505359 WIPI2 is a phosphatidylinsitol-3-phosphate binding protein required for starvation induced autophagy.

AA Sequence

MNLASQSGEAGAGQLLFANFNQDNTEVKGASRAAGLGRRAVVWSLAVGSKSGYKFFSLSSVDKLEQIYEC      1 - 70
TDTEDVCIVERLFSSSLVAIVSLKAPRKLKVCHFKKGTEICNYSYSNTILAVKLNRQRLIVCLEESLYIH     71 - 140
NIRDMKVLHTIRETPPNPAGLCALSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAALAF    141 - 210
DASGTKLATASEKGTVIRVFSIPEGQKLFEFRRGVKRCVSICSLAFSMDGMFLSASSNTETVHIFKLETV    211 - 280
KEKPPEEPTTWTGYFGKVLMASTSYLPSQVTEMFNQGRAFATVRLPFCGHKNICSLATIQKIPRLLVGAA    281 - 350
DGYLYMYNLDPQEGGECALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYT    351 - 420
DDLGAVGGACLEDEASALRLDEDSEHPPMILRTD                                        421 - 454
//

Publication (29)

PMID Year Title
25578879 2015 PI(5)P regulates autophagosome biogenesis.
25462558 2015 Fluorescence-based imaging of autophagy progression by human WIPI protein detection.
25416956 2014 A proteome-scale map of the human interactome network.
25233424 2014 WIPI ?-propellers at the crossroads of autophagosome and lipid droplet dynamics.
25233411 2014 WIPI2b and Atg16L1: setting the stage for autophagosome formation.
24991767 2014 WIPI-dependent autophagy during neutrophil differentiation of NB4 acute promyelocytic leukemia cells.
24954904 2014 WIPI2 links LC3 conjugation with PI3P, autophagosome formation, and pathogen clearance by recruiting Atg12-5-16L1.
23916833 2013 Inhibition of LRRK2 kinase activity stimulates macroautophagy.
23434374 2013 ZKSCAN3 is a master transcriptional repressor of autophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...