Property Summary

NCBI Gene PubMed Count 29
PubMed Score 10.73
PubTator Score 11.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
esophageal adenocarcinoma 1.100 0.025
osteosarcoma 1.319 0.000
tuberculosis and treatment for 6 months -1.100 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q9Y4P3 Q9UQE2
Symbols WBSCR13
WS-betaTRP

Gene

Gene RIF (13)

PMID Text
26239904 TBL2 participates in ATF4 translation through its association with the mRNA.
25976671 association of TBL2 with the 60S subunit was ER stress independent while the TBL2-PERK interaction occurred upon ER stress
25393282 TBL2 interacts with PERK via the N-terminus proximal region and also associates with eIF2a via the WD40 domain thus modulating stress-signaling and cell survival during endoplasmic reticulum stress.
23564352 A TERE1-TBL2 complex likely functions in oxidative/nitrosative stress, lipid metabolism, and SXR signaling pathways in its role as a tumor suppressor.
20972250 Observational study of gene-disease association. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20570916 Observational study of gene-disease association. (HuGE Navigator)
19656773 Data show that SNPs associated with TG in normolipidemic samples, including APOA5, TRIB1, TBL2, GCKR, GALNT2 and ANGPTL3 were significantly associated with HLP types 2B, 3, 4 and 5.
19656773 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MELSQMSELMGLSVLLGLLALMATAAVARGWLRAGEERSGRPACQKANGFPPDKSSGSKKQKQYQRIRKE      1 - 70
KPQQHNFTHRLLAAALKSHSGNISCMDFSSNGKYLATCADDRTIRIWSTKDFLQREHRSMRANVELDHAT     71 - 140
LVRFSPDCRAFIVWLANGDTLRVFKMTKREDGGYTFTATPEDFPKKHKAPVIDIGIANTGKFIMTASSDT    141 - 210
TVLIWSLKGQVLSTINTNQMNNTHAAVSPCGRFVASCGFTPDVKVWEVCFGKKGEFQEVVRAFELKGHSA    211 - 280
AVHSFAFSNDSRRMASVSKDGTWKLWDTDVEYKKKQDPYLLKTGRFEEAAGAAPCRLALSPNAQVLALAS    281 - 350
GSSIHLYNTRRGEKEECFERVHGECIANLSFDITGRFLASCGDRAVRLFHNTPGHRAMVEEMQGHLKRAS    351 - 420
NESTRQRLQQQLTQAQETLKSLGALKK                                               421 - 447
//

Publication (33)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26239904 2016 TBL2 Associates With ATF4 mRNA Via Its WD40 Domain and Regulates Its Translation During ER Stress.
25976671 2015 The endoplasmic reticulum-localized protein TBL2 interacts with the 60S ribosomal subunit.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25393282 2014 TBL2 is a novel PERK-binding protein that modulates stress-signaling and cell survival during endoplasmic reticulum stress.
25288136 2015 Genome-wide meta-analysis identifies six novel loci associated with habitual coffee consumption.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23564352 2013 The TERE1 protein interacts with mitochondrial TBL2: regulation of trans-membrane potential, ROS/RNS and SXR target genes.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
More...