Property Summary

NCBI Gene PubMed Count 34
Grant Count 10
R01 Count 5
Funding $1,569,803.5
PubMed Score 46.45
PubTator Score 30.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.400 0.000
osteosarcoma -1.195 0.001
breast carcinoma 1.300 0.012
ovarian cancer 1.500 0.000

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
504462 screening 1735 / 0 / 338616 uHTS fluorescent assay for identification of inhibitors of ATG4B
504475 summary 0 / 0 / 0 Summary assay for small molecule inhibitors of ATG4B
504756 confirmatory 289 / 0 / 29 Dose response confirmation of the uHTS fluorescent assay for identification of inhibitors of ATG4B.
504757 screening 291 / 0 / 27 Single concentration confirmation of inhibitors of ATG4B via a fluorescent assay
588584 confirmatory 3 / 0 / 13 Dose response confirmation of the uHTS fluorescent assay for identification of inhibitors of ATG4B Set 2

Gene RIF (12)

PMID Text
26499184 Results demonstrated that upregulation of miR-34a by transfection or demethylation resulted in the enhanced apoptosis and drug sensitivity in prostate cancer cells. ATG4B, directly regulated by miR-34a through AMPK/mTOR, was involved in this process.
25652856 Purified ATG4B protein interact with LC3B in vitro.
25490467 HIV-1 Vif binds more strongly to autophagy-related protein 4 (ATG4)-cleaved form I (LC3-I) than to ATG4-cleaved form II (LC3-II) in an A3G-independent manner
24991826 ATG4B independently plays a role as a positive regulator on tumor proliferation and a negative regulator on autophagy in colorectal cancer cells.
24755409 This study identifies ATG4B as a potential biomarker for predicting therapeutic response in treatment-naive chronic myeloid leukemia stem/progenitor cells and uncovers ATG4B as a possible drug target in these cells.
23508006 The actions of ATG4 family members (particularly ATG4B) are required for the control of autophagosome fusion with late, degradative compartments in differentiating human erythroblasts.
21177865 Atg4B possessed the broadest spectrum against all substrates, followed by Atg4A for ATG8 substrates
19322194 The crystal structures of catalytically inert human Atg4B in complex with processed and unprocessed forms of LC3 showed that, on LC3 binding, the regulatory loop and the N-terminal tail of HsAtg4B undergo large conformational changes.
16704426 Murine Atg8L/Apg8L modification is mediated by human Atg4B.
16325851 crystal structure of human Atg4b by X-ray crystallography at 2.0 A resolution, and show that Atg4b is a cysteine protease whose active catalytic triad site consists of Cys74, His280 and Asp278
More...

AA Sequence

MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDT      1 - 70
GWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIG     71 - 140
QWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGA    141 - 210
EVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPH    211 - 280
TTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFE    281 - 350
LVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL                               351 - 393
//

Text Mined References (47)

PMID Year Title
26499184 2016 Methylation-induced silencing of miR-34a enhances chemoresistance by directly upregulating ATG4B-induced autophagy through AMPK/mTOR pathway in prostate cancer.
25689150 2015 Autophagy modulates the effects of bis-anthracycline WP631 on p53-deficient prostate cancer cells.
25652856 2015 [The expression, purification and characterization of human His-ATG4B protein].
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
25126726 2014 FLCN, a novel autophagy component, interacts with GABARAP and is regulated by ULK1 phosphorylation.
24991826 2014 ATG4B promotes colorectal cancer growth independent of autophagic flux.
24755409 2014 The core autophagy protein ATG4B is a potential biomarker and therapeutic target in CML stem/progenitor cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23508006 2013 Autophagy facilitates organelle clearance during differentiation of human erythroblasts: evidence for a role for ATG4 paralogs during autophagosome maturation.
More...