Property Summary

NCBI Gene PubMed Count 41
PubMed Score 58.30
PubTator Score 30.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.1e-06
psoriasis 6694 2.9e-04
osteosarcoma 7950 1.5e-03
breast carcinoma 1638 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma 1.300 1.2e-02
osteosarcoma -1.195 1.5e-03
ovarian cancer 1.500 1.1e-06
psoriasis 1.400 2.9e-04

Gene RIF (19)

AA Sequence

MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDT      1 - 70
GWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIG     71 - 140
QWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGA    141 - 210
EVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPH    211 - 280
TTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFE    281 - 350
LVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL                               351 - 393
//

Text Mined References (54)

PMID Year Title