Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9Y4M8
Symbols C8orf71

 Compartment GO Term (0)

AA Sequence

MATFHRAHATSSVKPRARRHQEPNSGDWPGSYRAGTRCSAIGFRLLHSPQHWRPRSLGAGQGREDPSWEG      1 - 70
GALGDLKALWDQPCQPPPWVQLQLSSAYGARQQRWQLSTLPEPPAARTPGQMPQQRLIRAAGPSAAGGGN     71 - 140
QWLSPM                                                                    141 - 146
//

Text Mined References (4)

PMID Year Title